KEGG   Homo sapiens (human): 5979Help
Entry
5979              CDS       T01001                                 

Gene name
RET, CDHF12, CDHR16, HSCR1, MEN2A, MEN2B, MTC1, PTC, RET-ELE1, RET51
Definition
ret proto-oncogene (EC:2.7.10.1)
Orthology
K05126  
proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Pathways in cancer
Thyroid cancer
Central carbon metabolism in cancer
Disease
H00032  
Thyroid cancer
H00822  
Renal agenesis and Renal adysplasia
H00910  
Hirschsprung disease (HD)
H00916  
Congenital central hypoventilation syndrome (CCHS)
Drug target
Sunitinib: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    5979 (RET)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5979 (RET)
   05230 Central carbon metabolism in cancer
    5979 (RET)
   05216 Thyroid cancer
    5979 (RET)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     5979 (RET)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Ret family
   5979 (RET)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class XIV (RET receptor family)
   5979 (RET)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class XIV (RET receptor family)
   5979 (RET)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q11.2
AA seq 1072 aa AA seqDB search
MAKATSGAAGLRLLLLLLLPLLGKVALGLYFSRDAYWEKLYVDQAAGTPLLYVHALRDAP
EEVPSFRLGQHLYGTYRTRLHENNWICIQEDTGLLYLNRSLDHSSWEKLSVRNRGFPLLT
VYLKVFLSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRPSFRIRENR
PPGTFHQFRLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLEVSTRWALDREQREKYELV
AVCTVHAGAREEVVMVPFPVTVYDEDDSAPTFPAGVDTASAVVEFKRKEDTVVATLRVFD
ADVVPASGELVRRYTSTLLPGDTWAQQTFRVEHWPNETSVQANGSFVRATVHDYRLVLNR
NLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFA
QIGKVCVENCQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRPKCAE
LHYMVVATDQQTSRQAQAQLLVTVEGSYVAEEAGCPLSCAVSKRRLECEECGGLGSPTGR
CEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQDINICPQDCLRGSIVGGHEPGEPR
GIKAGYGTCNCFPEEEKCFCEPEDIQDPLCDELCRTVIAAAVLFSFIVSVLLSAFCIHCY
HKFAHKPPISSAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKILEDPKWEFP
RKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLK
QVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDH
PDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVY
EEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERL
FNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRRDYLDLAA
STPSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGRISHAFTRF
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcgacgtccggtgccgcggggctgcgtctgctgttgctgctgctgctgccg
ctgctaggcaaagtggcattgggcctctacttctcgagggatgcttactgggagaagctg
tatgtggaccaggcggccggcacgcccttgctgtacgtccatgccctgcgggacgcccct
gaggaggtgcccagcttccgcctgggccagcatctctacggcacgtaccgcacacggctg
catgagaacaactggatctgcatccaggaggacaccggcctcctctaccttaaccggagc
ctggaccatagctcctgggagaagctcagtgtccgcaaccgcggctttcccctgctcacc
gtctacctcaaggtcttcctgtcacccacatcccttcgtgagggcgagtgccagtggcca
ggctgtgcccgcgtatacttctccttcttcaacacctcctttccagcctgcagctccctc
aagccccgggagctctgcttcccagagacaaggccctccttccgcattcgggagaaccga
cccccaggcaccttccaccagttccgcctgctgcctgtgcagttcttgtgccccaacatc
agcgtggcctacaggctcctggagggtgagggtctgcccttccgctgcgccccggacagc
ctggaggtgagcacgcgctgggccctggaccgcgagcagcgggagaagtacgagctggtg
gccgtgtgcaccgtgcacgccggcgcgcgcgaggaggtggtgatggtgcccttcccggtg
accgtgtacgacgaggacgactcggcgcccaccttccccgcgggcgtcgacaccgccagc
gccgtggtggagttcaagcggaaggaggacaccgtggtggccacgctgcgtgtcttcgat
gcagacgtggtacctgcatcaggggagctggtgaggcggtacacaagcacgctgctcccc
ggggacacctgggcccagcagaccttccgggtggaacactggcccaacgagacctcggtc
caggccaacggcagcttcgtgcgggcgaccgtacatgactataggctggttctcaaccgg
aacctctccatctcggagaaccgcaccatgcagctggcggtgctggtcaatgactcagac
ttccagggcccaggagcgggcgtcctcttgctccacttcaacgtgtcggtgctgccggtc
agcctgcacctgcccagtacctactccctctccgtgagcaggagggctcgccgatttgcc
cagatcgggaaagtctgtgtggaaaactgccaggcattcagtggcatcaacgtccagtac
aagctgcattcctctggtgccaactgcagcacgctaggggtggtcacctcagccgaggac
acctcggggatcctgtttgtgaatgacaccaaggccctgcggcggcccaagtgtgccgaa
cttcactacatggtggtggccaccgaccagcagacctctaggcaggcccaggcccagctg
cttgtaacagtggaggggtcatatgtggccgaggaggcgggctgccccctgtcctgtgca
gtcagcaagagacggctggagtgtgaggagtgtggcggcctgggctccccaacaggcagg
tgtgagtggaggcaaggagatggcaaagggatcaccaggaacttctccacctgctctccc
agcaccaagacctgccccgacggccactgcgatgttgtggagacccaagacatcaacatt
tgccctcaggactgcctccggggcagcattgttgggggacacgagcctggggagccccgg
gggattaaagctggctatggcacctgcaactgcttccctgaggaggagaagtgcttctgc
gagcccgaagacatccaggatccactgtgcgacgagctgtgccgcacggtgatcgcagcc
gctgtcctcttctccttcatcgtctcggtgctgctgtctgccttctgcatccactgctac
cacaagtttgcccacaagccacccatctcctcagctgagatgaccttccggaggcccgcc
caggccttcccggtcagctactcctcttccggtgcccgccggccctcgctggactccatg
gagaaccaggtctccgtggatgccttcaagatcctggaggatccaaagtgggaattccct
cggaagaacttggttcttggaaaaactctaggagaaggcgaatttggaaaagtggtcaag
gcaacggccttccatctgaaaggcagagcagggtacaccacggtggccgtgaagatgctg
aaagagaacgcctccccgagtgagcttcgagacctgctgtcagagttcaacgtcctgaag
caggtcaaccacccacatgtcatcaaattgtatggggcctgcagccaggatggcccgctc
ctcctcatcgtggagtacgccaaatacggctccctgcggggcttcctccgcgagagccgc
aaagtggggcctggctacctgggcagtggaggcagccgcaactccagctccctggaccac
ccggatgagcgggccctcaccatgggcgacctcatctcatttgcctggcagatctcacag
gggatgcagtatctggccgagatgaagctcgttcatcgggacttggcagccagaaacatc
ctggtagctgaggggcggaagatgaagatttcggatttcggcttgtcccgagatgtttat
gaagaggattcctacgtgaagaggagccagggtcggattccagttaaatggatggcaatt
gaatccctttttgatcatatctacaccacgcaaagtgatgtatggtcttttggtgtcctg
ctgtgggagatcgtgaccctagggggaaacccctatcctgggattcctcctgagcggctc
ttcaaccttctgaagaccggccaccggatggagaggccagacaactgcagcgaggagatg
taccgcctgatgctgcaatgctggaagcaggagccggacaaaaggccggtgtttgcggac
atcagcaaagacctggagaagatgatggttaagaggagagactacttggaccttgcggcg
tccactccatctgactccctgatttatgacgacggcctctcagaggaggagacaccgctg
gtggactgtaataatgcccccctccctcgagccctcccttccacatggattgaaaacaaa
ctctatggtagaatttcccatgcatttactagattctag

DBGET integrated database retrieval system