KEGG   Homo sapiens (human): 5979Help
Entry
5979              CDS       T01001                                 

Gene name
RET, CDHF12, CDHR16, HSCR1, MEN2A, MEN2B, MTC1, PTC, RET-ELE1
Definition
(RefSeq) ret proto-oncogene
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05216  Thyroid cancer
hsa05230  Central carbon metabolism in cancer
Network
N00008  RET-PTC fusion kinase to RAS-ERK signaling pathway
Disease
H00032  Thyroid cancer
H00247  Multiple endocrine neoplasia syndrome (MEN)
H00822  Renal agenesis and Renal adysplasia
H00910  Hirschsprung disease (HD)
H00916  Congenital central hypoventilation syndrome (CCHS)
H01510  Malignant paraganglioma
H01592  Medullary thyroid cancer
Drug target
Cabozantinib (DG01670): D10062 D10095
Lenvatinib (DG01362): D09919 D09920
Motesanib (DG01262): D06678 D08947
Regorafenib (DG00720): D10137 D10138
Sorafenib (DG00713): D06272 D08524
Sunitinib (DG00712): D06402 D08552
Vandetanib: D06407
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5979 (RET)
   05230 Central carbon metabolism in cancer
    5979 (RET)
   05216 Thyroid cancer
    5979 (RET)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     5979 (RET)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  RET family
   5979 (RET)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Cadherin RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 5979
NCBI-ProteinID: NP_066124
OMIM: 164761
HGNC: 9967
Ensembl: ENSG00000165731
Vega: OTTHUMG00000018024
Pharos: P07949(Tclin)
UniProt: P07949 A0A024R7T2
Structure
PDB: 

Jmol
Position
10q11.21
AA seq 1114 aa AA seqDB search
MAKATSGAAGLRLLLLLLLPLLGKVALGLYFSRDAYWEKLYVDQAAGTPLLYVHALRDAP
EEVPSFRLGQHLYGTYRTRLHENNWICIQEDTGLLYLNRSLDHSSWEKLSVRNRGFPLLT
VYLKVFLSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRPSFRIRENR
PPGTFHQFRLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLEVSTRWALDREQREKYELV
AVCTVHAGAREEVVMVPFPVTVYDEDDSAPTFPAGVDTASAVVEFKRKEDTVVATLRVFD
ADVVPASGELVRRYTSTLLPGDTWAQQTFRVEHWPNETSVQANGSFVRATVHDYRLVLNR
NLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFA
QIGKVCVENCQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRPKCAE
LHYMVVATDQQTSRQAQAQLLVTVEGSYVAEEAGCPLSCAVSKRRLECEECGGLGSPTGR
CEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQDINICPQDCLRGSIVGGHEPGEPR
GIKAGYGTCNCFPEEEKCFCEPEDIQDPLCDELCRTVIAAAVLFSFIVSVLLSAFCIHCY
HKFAHKPPISSAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKILEDPKWEFP
RKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLK
QVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDH
PDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVY
EEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERL
FNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRRDYLDLAA
STPSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGMSDPNWPGESPVPLTRA
DGTNTGFPRYPNDSVYANWMLSPSAAKLMDTFDS
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcgacgtccggtgccgcggggctgcgtctgctgttgctgctgctgctgccg
ctgctaggcaaagtggcattgggcctctacttctcgagggatgcttactgggagaagctg
tatgtggaccaggcagccggcacgcccttgctgtacgtccatgccctgcgggacgcccct
gaggaggtgcccagcttccgcctgggccagcatctctacggcacgtaccgcacacggctg
catgagaacaactggatctgcatccaggaggacaccggcctcctctaccttaaccggagc
ctggaccatagctcctgggagaagctcagtgtccgcaaccgcggctttcccctgctcacc
gtctacctcaaggtcttcctgtcacccacatcccttcgtgagggcgagtgccagtggcca
ggctgtgcccgcgtatacttctccttcttcaacacctcctttccagcctgcagctccctc
aagccccgggagctctgcttcccagagacaaggccctccttccgcattcgggagaaccga
cccccaggcaccttccaccagttccgcctgctgcctgtgcagttcttgtgccccaacatc
agcgtggcctacaggctcctggagggtgagggtctgcccttccgctgcgccccggacagc
ctggaggtgagcacgcgctgggccctggaccgcgagcagcgggagaagtacgagctggtg
gccgtgtgcaccgtgcacgccggcgcgcgcgaggaggtggtgatggtgcccttcccggtg
accgtgtacgacgaggacgactcggcgcccaccttccccgcgggcgtcgacaccgccagc
gccgtggtggagttcaagcggaaggaggacaccgtggtggccacgctgcgtgtcttcgat
gcagacgtggtacctgcatcaggggagctggtgaggcggtacacaagcacgctgctcccc
ggggacacctgggcccagcagaccttccgggtggaacactggcccaacgagacctcggtc
caggccaacggcagcttcgtgcgggcgaccgtacatgactataggctggttctcaaccgg
aacctctccatctcggagaaccgcaccatgcagctggcggtgctggtcaatgactcagac
ttccagggcccaggagcgggcgtcctcttgctccacttcaacgtgtcggtgctgccggtc
agcctgcacctgcccagtacctactccctctccgtgagcaggagggctcgccgatttgcc
cagatcgggaaagtctgtgtggaaaactgccaggcattcagtggcatcaacgtccagtac
aagctgcattcctctggtgccaactgcagcacgctaggggtggtcacctcagccgaggac
acctcggggatcctgtttgtgaatgacaccaaggccctgcggcggcccaagtgtgccgaa
cttcactacatggtggtggccaccgaccagcagacctctaggcaggcccaggcccagctg
cttgtaacagtggaggggtcatatgtggccgaggaggcgggctgccccctgtcctgtgca
gtcagcaagagacggctggagtgtgaggagtgtggcggcctgggctccccaacaggcagg
tgtgagtggaggcaaggagatggcaaagggatcaccaggaacttctccacctgctctccc
agcaccaagacctgccccgacggccactgcgatgttgtggagacccaagacatcaacatt
tgccctcaggactgcctccggggcagcattgttgggggacacgagcctggggagccccgg
gggattaaagctggctatggcacctgcaactgcttccctgaggaggagaagtgcttctgc
gagcccgaagacatccaggatccactgtgcgacgagctgtgccgcacggtgatcgcagcc
gctgtcctcttctccttcatcgtctcggtgctgctgtctgccttctgcatccactgctac
cacaagtttgcccacaagccacccatctcctcagctgagatgaccttccggaggcccgcc
caggccttcccggtcagctactcctcttccggtgcccgccggccctcgctggactccatg
gagaaccaggtctccgtggatgccttcaagatcctggaggatccaaagtgggaattccct
cggaagaacttggttcttggaaaaactctaggagaaggcgaatttggaaaagtggtcaag
gcaacggccttccatctgaaaggcagagcagggtacaccacggtggccgtgaagatgctg
aaagagaacgcctccccgagtgagctgcgagacctgctgtcagagttcaacgtcctgaag
caggtcaaccacccacatgtcatcaaattgtatggggcctgcagccaggatggcccgctc
ctcctcatcgtggagtacgccaaatacggctccctgcggggcttcctccgcgagagccgc
aaagtggggcctggctacctgggcagtggaggcagccgcaactccagctccctggaccac
ccggatgagcgggccctcaccatgggcgacctcatctcatttgcctggcagatctcacag
gggatgcagtatctggccgagatgaagctcgttcatcgggacttggcagccagaaacatc
ctggtagctgaggggcggaagatgaagatttcggatttcggcttgtcccgagatgtttat
gaagaggattcctacgtgaagaggagccagggtcggattccagttaaatggatggcaatt
gaatccctttttgatcatatctacaccacgcaaagtgatgtatggtcttttggtgtcctg
ctgtgggagatcgtgaccctagggggaaacccctatcctgggattcctcctgagcggctc
ttcaaccttctgaagaccggccaccggatggagaggccagacaactgcagcgaggagatg
taccgcctgatgctgcaatgctggaagcaggagccggacaaaaggccggtgtttgcggac
atcagcaaagacctggagaagatgatggttaagaggagagactacttggaccttgcggcg
tccactccatctgactccctgatttatgacgacggcctctcagaggaggagacaccgctg
gtggactgtaataatgcccccctccctcgagccctcccttccacatggattgaaaacaaa
ctctatggcatgtcagacccgaactggcctggagagagtcctgtaccactcacgagagct
gatggcactaacactgggtttccaagatatccaaatgatagtgtatatgctaactggatg
ctttcaccctcagcggcaaaattaatggacacgtttgatagttaa

DBGET integrated database retrieval system