KEGG   Homo sapiens (human): 5980Help
Entry
5980              CDS       T01001                                 

Gene name
REV3L, POLZ, REV3
Definition
(RefSeq) REV3 like, DNA directed polymerase zeta catalytic subunit (EC:2.7.7.7)
  KO
K02350  
DNA polymerase zeta [EC:2.7.7.7]
Organism
hsa  Homo sapiens (human)
Pathway
Metabolic pathways
Platinum drug resistance
Fanconi anemia pathway
Module
DNA polymerase zeta  complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    5980 (REV3L)
 Human Diseases
  Antineoplastic resistance
   01524 Platinum drug resistance
    5980 (REV3L)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     5980 (REV3L)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   B-family DNA polymerases
    5980 (REV3L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q21
AA seq 3130 aa AA seqDB search
MFSVRIVTADYYMASPLQGLDTCQSPLTQAPVKKVPVVRVFGATPAGQKTCLHLHGIFPY
LYVPYDGYGQQPESYLSQMAFSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKER
HFMKIYLYNPTMVKRICELLQSGAIMNKFYQPHEAHIPYLLQLFIDYNLYGMNLINLAAV
KFRKARRKSNTLHATGSCKNHLSGNSLADTLFRWEQDEIPSSLILEGVEPQSTCELEVDA
VAADILNRLDIEAQIGGNPGLQAIWEDEKQRRRNRNETSQMSQPESQDHRFVPATESEKK
FQKRLQEILKQNDFSVTLSGSVDYSDGSQEFSAELTLHSEVLSPEMLQCTPANMVEVHKD
KESSKGHTRHKVEEALINEEAILNLMENSQTFQPLTQRLSESPVFMDSSPDEALVHLLAG
LESDGYRGERNRMPSPCRSFGNNKYPQNSDDEENEPQIEKEEMELSLVMSQRWDSNIEEH
CAKKRSLCRNTHRSSTEDDDSSSGEEMEWSDNSLLLASLSIPQLDGTADENSDNPLNNEN
SRTHSSVIATSKLSVKPSIFHKDAATLEPSSSAKITFQCKHTSALSSHVLNKEDLIEDLS
QTNKNTEKGLDNSVTSFTNESTYSMKYPGSLSSTVHSENSHKENSKKEILPVSSCESSIF
DYEEDIPSVTRQVPSRKYTNIRKIEKDSPFIHMHRHPNENTLGKNSFNFSDLNHSKNKVS
SEGNEKGNSTALSSLFPSSFTENCELLSCSGENRTMVHSLNSTADESGLNKLKIRYEEFQ
EHKTEKPSLSQQAAHYMFFPSVVLSNCLTRPQKLSPVTYKLQPGNKPSRLKLNKRKLAGH
QETSTKSSETGSTKDNFIQNNPCNSNPEKDNALASDLTKTTRGAFENKTPTDGFIDCHFG
DGTLETEQSFGLYGNKYTLRAKRKVNYETEDSESSFVTHNSKISLPHPMEIGESLDGTLK
SRKRRKMSKKLPPVIIKYIIINRFRGRKNMLVKLGKIDSKEKQVILTEEKMELYKKLAPL
KDFWPKVPDSPATKYPIYPLTPKKSHRRKSKHKSAKKKTGKQQRTNNENIKRTLSFRKKR
SHAILSPPSPSYNAETEDCDLNYSDVMSKLGFLSERSTSPINSSPPRCWSPTDPRAEEIM
AAAEKEAMLFKGPNVYKKTVNSRIGKTSRARAQIKKSKAKLANPSIVTKKRNKRNQTNKL
VDDGKKKPRAKQKTNEKGTSRKHTTLKDEKIKSQSGAEVKFVLKHQNVSEFASSSGGSQL
LFKQKDMPLMGSAVDHPLSASLPTGINAQQKLSGCFSSFLESKKSVDLQTFPSSRDDLHP
SVVCNSIGPGVSKINVQRPHNQSAMFTLKESTLIQKNIFDLSNHLSQVAQNTQISSGMSS
KIEDNANNIQRNYLSSIGKLSEYRNSLESKLDQAYTPNFLHCKDSQQQIVCIAEQSKHSE
TCSPGNTASEESQMPNNCFVTSLRSPIKQIAWEQKQRGFILDMSNFKPERVKPRSLSEAI
SQTKALSQCKNRNVSTPSAFGEGQSGLAVLKELLQKRQQKAQNANTTQDPLSNKHQPNKN
ISGSLEHNKANKRTRSVTSPRKPRTPRSTKQKEKIPKLLKVDSLNLQNSSQLDNSVSDDS
PIFFSDPGFESCYSLEDSLSPEHNYNFDINTIGQTGFCSFYSGSQFVPADQNLPQKFLSD
AVQDLFPGQAIEKNEFLSHDNQKCDEDKHHTTDSASWIRSGTLSPEIFEKSTIDSNENRR
HNQWKNSFHPLTTRSNSIMDSFCVQQAEDCLSEKSRLNRSSVSKEVFLSLPQPNNSDWIQ
GHTRKEMGQSLDSANTSFTAILSSPDGELVDVACEDLELYVSRNNDMLTPTPDSSPRSTS
SPSQSKNGSFTPRTANILKPLMSPPSREEIMATLLDHDLSETIYQEPFCSNPSDVPEKPR
EIGGRLLMVETRLANDLAEFEGDFSLEGLRLWKTAFSAMTQNPRPGSPLRSGQGVVNKGS
SNSPKMVEDKKIVIMPCKCAPSRQLVQVWLQAKEEYERSKKLPKTKPTGVVKSAENFSSS
VNPDDKPVVPPKMDVSPCILPTTAHTKEDVDNSQIALQAPTTGCSQTASESQMLPPVASA
SDPEKDEDDDDNYYISYSSPDSPVIPPWQQPISPDSKALNGDDRPSSPVEELPSLAFENF
LKPIKDGIQKSPCSEPQEPLVISPINTRARTGKCESLCFHSTPIIQRKLLERLPEAPGLS
PLSTEPKTQKLSNKKGSNTDTLRRVLLTQAKNQFAAVNTPQKETSQIDGPSLNNTYGFKV
SIQNLQEAKALHEIQNLTLISVELHARTRRDLEPDPEFDPICALFYCISSDTPLPDTEKT
ELTGVIVIDKDKTVFSQDIRYQTPLLIRSGITGLEVTYAADEKALFHEIANIIKRYDPDI
LLGYEIQMHSWGYLLQRAAALSIDLCRMISRVPDDKIENRFAAERDEYGSYTMSEINIVG
RITLNLWRIMRNEVALTNYTFENVSFHVLHQRFPLFTFRVLSDWFDNKTDLYRWKMVDHY
VSRVRGNLQMLEQLDLIGKTSEMARLFGIQFLHVLTRGSQYRVESMMLRIAKPMNYIPVT
PSVQQRSQMRAPQCVPLIMEPESRFYSNSVLVLDFQSLYPSIVIAYNYCFSTCLGHVENL
GKYDEFKFGCTSLRVPPDLLYQVRHDITVSPNGVAFVKPSVRKGVLPRMLEEILKTRFMV
KQSMKAYKQDRALSRMLDARQLGLKLIANVTFGYTSANFSGRMPCIEVGDSIVHKARETL
ERAIKLVNDTKKWGARVVYGDTDSMFVLLKGATKEQSFKIGQEIAEAVTATNPKPVKLKF
EKVYLPCVLQTKKRYVGYMYETLDQKDPVFDAKGIETVRRDSCPAVSKILERSLKLLFET
RDISLIKQYVQRQCMKLLEGKASIQDFIFAKEYRGSFSYKPGACVPALELTRKMLTYDRR
SEPQVGERVPYVIIYGTPGVPLIQLVRRPVEVLQDPTLRLNATYYITKQILPPLARIFSL
IGIDVFSWYHELPRIHKATSSSRSEPEGRKGTISQYFTTLHCPVCDDLTQHGICSKCRSQ
PQHVAVILNQEIRELERQQEQLVKICKNCTGCFDRHIPCVSLNCPVLFKLSRVNRELSKA
PYLRQLLDQF
NT seq 9393 nt NT seq  +upstreamnt  +downstreamnt
atgttttcagtaaggatagtgactgcagactactacatggccagcccgctgcaggggctg
gatacctgccaatcccccctcacccaggcccctgtcaagaaggtgccggtggtgcgagtc
ttcggagcgaccccggcaggtcagaagacatgtcttcatctacatggcatctttccttac
ctctatgtgccatacgatggttatggacagcagccagaaagctatctttctcagatggca
ttcagtatcgacagagcacttaatgtggctttaggcaatccatcttccactgctcagcat
gtgttcaaagtgtcattagtatcaggaatgcctttttatggttatcatgagaaggaaaga
cactttatgaagatctatctttacaatcctacaatggtgaaaaggatatgtgaacttttg
caaagcggagccataatgaataaattttaccagcctcatgaagcgcatattccctacctc
ctacagctcttcattgactacaatctttatggcatgaatttaataaatctggctgctgtc
aagttccgaaaagcaagaaggaaaagtaatacattgcatgcaactggatcctgcaagaat
catttatcaggaaattctcttgctgatactttatttcggtgggaacaagatgaaatacca
agctctttaatattggaaggtgttgaaccacagagtacatgtgaattagaagtggatgct
gtagctgctgatatcttaaatcgtctggacattgaagctcaaattggtggaaaccctggt
ctacaggccatatgggaagatgaaaagcaacggcgaagaaacagaaatgaaacttctcaa
atgagccaacctgagtcacaagatcacaggtttgtgccagcaacagaaagtgaaaaaaaa
tttcagaagagacttcaggaaattctcaaacagaatgatttctctgtaacattatcagga
tctgtggactacagcgatggatcccaggagttctctgctgagttaacattgcactctgag
gttctgtctcctgaaatgcttcagtgtacaccagccaatatggtagaagttcacaaagac
aaagagtcaagcaaaggtcacactagacacaaagtggaagaagctcttattaatgaagaa
gcaattttgaaccttatggaaaatagtcagacttttcagcctttgacccaaagactgagt
gagtcacctgttttcatggacagtagtcctgatgaggctctggtacatcttcttgctggt
ttggaaagtgatggatatcggggggaaagaaataggatgccatcaccatgtcgctccttt
ggaaataataaatatccacaaaatagtgatgatgaagaaaatgaaccacagattgaaaaa
gaggaaatggagcttagtttggtgatgtcccagagatgggacagcaatattgaagaacat
tgtgccaaaaagagatcactgtgcagaaatacccacagaagttcaactgaagatgatgac
tcatcttcaggagaagaaatggaatggagtgataacagtttgcttctagccagtctttct
atacctcagttagatggaactgcagatgaaaatagtgacaatccattgaacaatgaaaat
tctagaacccactcttctgtaattgcaacaagcaagctttcagttaaaccctccatcttt
cacaaagatgctgctacattagaaccctcatcttctgctaagattacctttcagtgtaaa
cacacaagtgccctttcttcccatgttttgaacaaggaagatttaattgaagacctttca
cagacaaacaaaaatacagaaaaaggtctagataactcagtcacttcttttacaaacgaa
agcacttattctatgaaataccctggatctttaagcagtactgttcattcagaaaattct
cataaagagaatagtaagaaagagatcctcccagtatcttcctgtgaaagtagtattttt
gattatgaagaagatattccatctgttacaagacaagtaccaagtagaaaatatacaaac
attagaaaaatcgaaaaggattccccttttatacatatgcaccgtcaccctaacgagaat
acattgggcaaaaattctttcaacttttctgacttaaatcattcaaaaaataaagtatcc
tctgaaggaaatgaaaaaggaaacagcacagctctgagtagtttattcccttcatcattt
actgaaaattgtgaattactgtcatgctcaggggagaatagaactatggtgcattctctt
aatagcactgctgatgaaagtggactaaataaacttaaaattaggtatgaagaatttcaa
gaacataaaacagaaaagccaagcctcagccagcaagcagcacactatatgttttttccc
agtgttgttctttctaactgtcttactagaccacagaaactatctcctgtcacatataaa
ttacaacctggcaataaaccatcccggttaaaattgaataaaaggaaacttgcaggtcat
caggagacttctaccaaaagtagtgagactggatccacaaaagataattttatacaaaat
aatccttgtaatagtaatcctgagaaggataatgcattggctagtgatttaactaaaacc
actcgtggagcttttgaaaataaaacacccacagatggttttatagactgtcactttgga
gatggaacgttagaaactgagcagtcctttggactatatggaaataaatacacacttaga
gccaaacgcaaggtaaattatgagactgaagacagtgagtcaagttttgtaactcacaac
tcaaaaattagtctacctcatcccatggaaattggtgaaagtttagatggaactctcaaa
tcccgaaaacgaagaaaaatgtctaaaaagctgccccctgtcatcataaagtatattatt
attaatagatttagagggagaaaaaatatgcttgtgaagctaggaaaaatagactctaaa
gaaaaacaagtaatattaacagaagaaaaaatggaactatataaaaagcttgcacctttg
aaggacttttggccaaaagttcccgactcccctgcaaccaaatatcccatttatccacta
acaccaaagaaaagtcacagaagaaagtcaaaacataaatctgctaagaaaaaaactggt
aaacaacaaaggacaaataatgaaaatattaaaagaactttgtctttcaggaaaaaacgg
tcacatgctattctttctcctccctcaccatcttacaatgctgaaaccgaagattgtgac
ctgaattatagtgatgttatgtctaaactaggttttctttctgagagaagcacaagtccc
ataaattcttctccacctcgctgctggtctcccacagatccaagagctgaagaaatcatg
gctgctgcagaaaaagaggcaatgctttttaagggtcctaatgtatataagaagactgtt
aattctcgtataggaaaaactagtcgcgcaagagcacagattaagaaatcaaaagcaaag
cttgctaatccctctatagttactaagaaaaggaacaaacgaaatcagacaaataaacta
gtagatgatggaaaaaagaaaccaagagcaaaacaaaaaacaaatgagaaaggtacatcg
agaaagcatacaacacttaaggatgaaaaaataaaatctcagtctggtgctgaggttaag
tttgtactgaaacaccagaatgtgtctgaatttgcaagtagttctggaggctctcaacta
ctttttaaacagaaagatatgccactaatgggctctgctgtagatcatcccctttctgct
tccctacccactggaattaatgcacaacagaagttatctggctgcttttcttctttctta
gaaagcaagaagtctgtagatttgcagacattccccagttcacgagatgatttgcatcca
tcagttgtttgtaattctataggacctggagtctcaaaaattaatgttcaaaggcctcat
aatcaaagtgctatgtttactctaaaggaatcaacgttaattcaaaaaaatatatttgac
ctttccaatcatttatctcaggtagcacagaatacacagatatcttctggtatgtcctca
aagatagaagataatgcaaataatatacaaagaaactatttgtcatcaatcggaaagtta
agtgaatatcgcaattccctagaatcaaagctggaccaagcatatacccctaattttttg
cattgcaaagacagtcagcagcagattgtgtgcatagcggaacagtcaaagcacagtgaa
acttgttctccgggaaatacagcttcagaggaaagccaaatgcctaataattgctttgta
acttccttgagaagtccaatcaaacaaatagcatgggagcaaaagcaaaggggctttatt
ttagatatgtcaaattttaaacctgaaagagtaaaaccgaggtcgttatcagaagcaatt
tcacaaaccaaagcactttctcagtgtaaaaatcgaaatgtgtcaacaccttcagcattt
ggtgaaggacagtctggactggcagttctaaaagaattgttacaaaaaagacagcagaaa
gcacaaaatgcaaatactacacaagacccattatccaataaacatcaaccaaataaaaat
atttctggttcccttgagcataacaaagcaaataaacggacacgatcggtaacgtcccca
agaaaacctcgaactcccagaagtacaaaacaaaaagaaaaaatccccaaacttctcaaa
gtagactctttaaatttacaaaactctagccagttggataactctgtatcagatgatagt
cccatctttttttcagatccaggctttgaaagttgttactcacttgaagatagtttatct
cctgaacataattataattttgatattaacacaataggtcagactggattttgtagcttt
tattctggaagtcagtttgtcccagctgatcagaatttgcctcagaagttcctaagtgat
gctgttcaggatctttttccaggacaagctatagaaaaaaatgagtttttaagtcatgac
aaccagaaatgtgatgaagacaagcatcataccacagactcagcctcatggattagatct
ggtactttaagtcctgaaatttttgagaagtcaaccatagatagcaatgagaatcgtcgc
cacaaccagtggaaaaatagctttcatcctctaacaactcggtctaactcaataatggat
tctttctgtgttcagcaggcagaagactgtctaagtgaaaaatctagattgaataggagt
tcagtaagcaaagaagtgtttcttagcctcccacagccaaacaattcagactggattcaa
ggtcacaccagaaaagaaatgggacagtctcttgactcagccaatacctcttttactgca
atactctcctcccctgatggtgaacttgtagacgtggcctgtgaagatttagaactgtat
gtttcaagaaacaatgatatgttgacaccaactcctgatagttcaccaagatctactagc
tctccttcacaatctaaaaatggcagcttcacccctcgaactgctaacattctgaaacca
cttatgtcccccccaagtagggaagaaattatggcaactttgttggatcatgacctgtct
gagactatttaccaggaaccattttgcagtaatccttctgatgtaccagaaaagcccagg
gagattggtggacggctcctcatggtagaaactcgacttgcaaatgatctggctgagttt
gagggagacttttccttggaaggacttcgtctttggaaaacagcattctcagcaatgact
cagaatccaaggccagggtcaccccttcgcagtggccaaggagttgtcaataaagggtca
agtaatagccctaagatggttgaagataaaaaaattgtgattatgccttgcaaatgtgcc
ccaagtcgacaactggttcaagtgtggcttcaagccaaagaagaatacgaacgttccaag
aaactgcctaaaaccaagccaactggagttgtaaaatctgctgagaactttagctcttca
gttaacccagatgacaaacctgtagtgcctccaaaaatggatgtaagtccatgtatactc
cccactacagcacataccaaggaggatgttgataattctcagattgctttacaagcacca
accacgggatgtagtcaaactgcaagtgaaagtcagatgctgccaccagttgcctctgca
agtgatcccgaaaaagatgaagatgatgatgataactattacattagttatagctcccct
gattctccagtaattcccccttggcaacaaccaatatccccagattccaaagcattaaat
ggagatgatagaccctcatcaccagtagaggagctgccttcattggcttttgagaacttc
ttaaagccaataaaagatggtatacaaaaaagcccctgcagtgagcctcaagagcctcta
gtgatatctccaattaatactagggcaagaactgggaaatgtgaatcactttgctttcat
agtacaccaatcatacagagaaaacttctggaaaggcttcctgaagcacctggccttagc
ccattatcaacagaaccaaaaacacagaagttgagtaataagaaaggaagtaatactgac
actcttagaagagtactgttaacacaagcaaagaatcaatttgcagcagtaaatacccca
cagaaagaaacttctcagattgatggaccatctttaaacaatacttacggtttcaaagtc
agcatacaaaacttacaggaggcaaaagctttacatgagatacaaaatcttaccctaatc
agtgtggagttgcatgctcgaactagacgagacttagaaccggatcctgaatttgaccca
atctgtgctctgttctactgcatctcatctgacactccactgccagatacagaaaaaaca
gaactcacaggtgtaatagtgattgataaagacaagacagttttcagtcaagatatcaga
tatcagactccattacttattagatctggaattacaggactcgaagtcacctatgctgct
gatgagaaggcactttttcatgaaattgcaaatataataaagaggtatgatcctgatatt
ctgctaggatatgagattcagatgcattcctggggttacctcttacaaagggctgccgct
ttaagtattgacttatgtcggatgatctctcgggtgccagatgacaaaattgagaacaga
tttgcagctgaaagagatgagtatggatcatatacaatgagtgagataaatattgttggc
cgaattacactaaatctttggagaatcatgagaaatgaggtggctctaactaactacacc
tttgaaaatgtgagctttcatgttcttcatcagcgttttcccctctttacctttcgagtc
ttgtcagactggtttgataacaagacagatctatacagatggaaaatggttgatcattat
gttagccgtgtccgtggaaatctccaaatgttagaacagctggacctgattgggaaaacc
agtgagatggctagactttttggcattcagtttttacatgtactgacaaggggttcacag
taccgtgtggaatcaatgatgttgcgtattgctaaaccaatgaactatattcctgtgaca
cctagtgttcagcaaagatcccagatgagagccccacagtgtgttcctctaattatggag
cctgaatcccgcttctatagcaactctgttctcgttttggatttccaatcactttatcct
tctattgtgattgcatataactactgcttttccacctgccttggccatgtggagaacttg
ggaaagtatgatgagttcaaatttggctgtacctctctgagagtacctccagatttactt
taccaagttaggcatgatatcacagtgtcccccaatggagtagcttttgtcaagccttca
gtaagaaaaggtgtactaccaagaatgcttgaagaaattttgaagactagatttatggtg
aagcagtcaatgaaggcttacaagcaagacagagccctgtcacgaatgcttgatgcgcgt
cagttgggacttaagctgatagcaaatgtcacatttggctatacatctgctaatttttct
gggagaatgccatgcattgaggttggcgatagtattgttcacaaagccagagagaccttg
gaacgagctattaaactggtgaatgataccaagaaatggggggctagggttgtatatggc
gatactgacagtatgtttgtgctactgaaaggagccactaaggagcagtcttttaagatt
ggtcaggaaattgccgaagctgtaactgctaccaatcctaaaccagtgaaattgaagttt
gaaaaggtatatttgccctgtgttttacaaacaaaaaagaggtatgtgggttacatgtat
gaaacactggatcagaaggacccagtatttgatgcaaaaggaatagaaacagtcagaaga
gattcctgccctgctgtttctaagatacttgagcgttctctaaagctgctatttgaaacg
agagatataagtctaattaaacagtatgttcagcgacaatgtatgaagcttctggaagga
aaggccagcatacaagactttatctttgccaaggaatacagaggaagtttttcttataaa
ccaggagcttgtgtgccagcccttgaacttacaaggaaaatgctgacttatgaccggcgc
tctgagcctcaggttggggagcgagtgccatacgtcatcatttatgggacccccggagta
ccacttatccagcttgtaaggcgcccagtggaagtcctgcaggacccaactctgagactg
aatgctacttactatattaccaagcaaatccttccacccttggcaagaatcttctcactt
attggtattgatgtcttcagctggtatcatgaattaccaaggatccataaagctaccagc
tcctcgcgaagtgaacctgaagggcggaaaggcactatttcacaatattttactacctta
cactgtcctgtgtgtgatgacctaactcagcatggcatctgtagtaaatgtcggagccaa
cctcagcatgttgcagtcatcctcaaccaagaaatccgggagttggaacgtcaacaggag
caacttgtaaagatatgcaagaactgtacaggttgctttgatcgacacatcccatgtgtt
tctctgaactgcccagtacttttcaaactctcccgagtaaatagagaattgtccaaggca
ccatatctccggcagttattagaccagttttaa

DBGET integrated database retrieval system