KEGG   Homo sapiens (human): 5980Help
Entry
5980              CDS       T01001                                 

Gene name
REV3L, POLZ, REV3
Definition
REV3-like, polymerase (DNA directed), zeta, catalytic subunit (EC:2.7.7.7)
Orthology
K02350  
DNA polymerase zeta [EC:2.7.7.7]
Organism
hsa  Homo sapiens (human)
Pathway
Metabolic pathways
Fanconi anemia pathway
Module
DNA polymerase zeta  complex
Class
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:hsa03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q21
AA seq 3052 aa AA seqDB search
MAFSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKERHFMKIYLYNPTMVKRICE
LLQSGAIMNKFYQPHEAHIPYLLQLFIDYNLYGMNLINLAAVKFRKARRKSNTLHATGSC
KNHLSGNSLADTLFRWEQDEIPSSLILEGVEPQSTCELEVDAVAADILNRLDIEAQIGGN
PGLQAIWEDEKQRRRNRNETSQMSQPESQDHRFVPATESEKKFQKRLQEILKQNDFSVTL
SGSVDYSDGSQEFSAELTLHSEVLSPEMLQCTPANMVEVHKDKESSKGHTRHKVEEALIN
EEAILNLMENSQTFQPLTQRLSESPVFMDSSPDEALVHLLAGLESDGYRGERNRMPSPCR
SFGNNKYPQNSDDEENEPQIEKEEMELSLVMSQRWDSNIEEHCAKKRSLCRNTHRSSTED
DDSSSGEEMEWSDNSLLLASLSIPQLDGTADENSDNPLNNENSRTHSSVIATSKLSVKPS
IFHKDAATLEPSSSAKITFQCKHTSALSSHVLNKEDLIEDLSQTNKNTEKGLDNSVTSFT
NESTYSMKYPGSLSSTVHSENSHKENSKKEILPVSSCESSIFDYEEDIPSVTRQVPSRKY
TNIRKIEKDSPFIHMHRHPNENTLGKNSFNFSDLNHSKNKVSSEGNEKGNSTALSSLFPS
SFTENCELLSCSGENRTMVHSLNSTADESGLNKLKIRYEEFQEHKTEKPSLSQQAAHYMF
FPSVVLSNCLTRPQKLSPVTYKLQPGNKPSRLKLNKRKLAGHQETSTKSSETGSTKDNFI
QNNPCNSNPEKDNALASDLTKTTRGAFENKTPTDGFIDCHFGDGTLETEQSFGLYGNKYT
LRAKRKVNYETEDSESSFVTHNSKISLPHPMEIGESLDGTLKSRKRRKMSKKLPPVIIKY
IIINRFRGRKNMLVKLGKIDSKEKQVILTEEKMELYKKLAPLKDFWPKVPDSPATKYPIY
PLTPKKSHRRKSKHKSAKKKTGKQQRTNNENIKRTLSFRKKRSHAILSPPSPSYNAETED
CDLNYSDVMSKLGFLSERSTSPINSSPPRCWSPTDPRAEEIMAAAEKEAMLFKGPNVYKK
TVNSRIGKTSRARAQIKKSKAKLANPSIVTKKRNKRNQTNKLVDDGKKKPRAKQKTNEKG
TSRKHTTLKDEKIKSQSGAEVKFVLKHQNVSEFASSSGGSQLLFKQKDMPLMGSAVDHPL
SASLPTGINAQQKLSGCFSSFLESKKSVDLQTFPSSRDDLHPSVVCNSIGPGVSKINVQR
PHNQSAMFTLKESTLIQKNIFDLSNHLSQVAQNTQISSGMSSKIEDNANNIQRNYLSSIG
KLSEYRNSLESKLDQAYTPNFLHCKDSQQQIVCIAEQSKHSETCSPGNTASEESQMPNNC
FVTSLRSPIKQIAWEQKQRGFILDMSNFKPERVKPRSLSEAISQTKALSQCKNRNVSTPS
AFGEGQSGLAVLKELLQKRQQKAQNANTTQDPLSNKHQPNKNISGSLEHNKANKRTRSVT
SPRKPRTPRSTKQKEKIPKLLKVDSLNLQNSSQLDNSVSDDSPIFFSDPGFESCYSLEDS
LSPEHNYNFDINTIGQTGFCSFYSGSQFVPADQNLPQKFLSDAVQDLFPGQAIEKNEFLS
HDNQKCDEDKHHTTDSASWIRSGTLSPEIFEKSTIDSNENRRHNQWKNSFHPLTTRSNSI
MDSFCVQQAEDCLSEKSRLNRSSVSKEVFLSLPQPNNSDWIQGHTRKEMGQSLDSANTSF
TAILSSPDGELVDVACEDLELYVSRNNDMLTPTPDSSPRSTSSPSQSKNGSFTPRTANIL
KPLMSPPSREEIMATLLDHDLSETIYQEPFCSNPSDVPEKPREIGGRLLMVETRLANDLA
EFEGDFSLEGLRLWKTAFSAMTQNPRPGSPLRSGQGVVNKGSSNSPKMVEDKKIVIMPCK
CAPSRQLVQVWLQAKEEYERSKKLPKTKPTGVVKSAENFSSSVNPDDKPVVPPKMDVSPC
ILPTTAHTKEDVDNSQIALQAPTTGCSQTASESQMLPPVASASDPEKDEDDDDNYYISYS
SPDSPVIPPWQQPISPDSKALNGDDRPSSPVEELPSLAFENFLKPIKDGIQKSPCSEPQE
PLVISPINTRARTGKCESLCFHSTPIIQRKLLERLPEAPGLSPLSTEPKTQKLSNKKGSN
TDTLRRVLLTQAKNQFAAVNTPQKETSQIDGPSLNNTYGFKVSIQNLQEAKALHEIQNLT
LISVELHARTRRDLEPDPEFDPICALFYCISSDTPLPDTEKTELTGVIVIDKDKTVFSQD
IRYQTPLLIRSGITGLEVTYAADEKALFHEIANIIKRYDPDILLGYEIQMHSWGYLLQRA
AALSIDLCRMISRVPDDKIENRFAAERDEYGSYTMSEINIVGRITLNLWRIMRNEVALTN
YTFENVSFHVLHQRFPLFTFRVLSDWFDNKTDLYRWKMVDHYVSRVRGNLQMLEQLDLIG
KTSEMARLFGIQFLHVLTRGSQYRVESMMLRIAKPMNYIPVTPSVQQRSQMRAPQCVPLI
MEPESRFYSNSVLVLDFQSLYPSIVIAYNYCFSTCLGHVENLGKYDEFKFGCTSLRVPPD
LLYQVRHDITVSPNGVAFVKPSVRKGVLPRMLEEILKTRFMVKQSMKAYKQDRALSRMLD
ARQLGLKLIANVTFGYTSANFSGRMPCIEVGDSIVHKARETLERAIKLVNDTKKWGARVV
YGDTDSMFVLLKGATKEQSFKIGQEIAEAVTATNPKPVKLKFEKVYLPCVLQTKKRYVGY
MYETLDQKDPVFDAKGIETVRRDSCPAVSKILERSLKLLFETRDISLIKQYVQRQCMKLL
EGKASIQDFIFAKEYRGSFSYKPGACVPALELTRKMLTYDRRSEPQVGERVPYVIIYGTP
GVPLIQLVRRPVEVLQDPTLRLNATYYITKQILPPLARIFSLIGIDVFSWYHELPRIHKA
TSSSRSEPEGRKGTISQYFTTLHCPVCDDLTQHGICSKCRSQPQHVAVILNQEIRELERQ
QEQLVKICKNCTGCFDRHIPCVSLNCPVLFKLSRVNRELSKAPYLRQLLDQF
NT seq 9159 nt NT seq  +upstreamnt  +downstreamnt
atggcattcagtatcgacagagcacttaatgtggctttaggcaatccatcttccactgct
cagcatgtgttcaaagtgtcattagtatcaggaatgcctttttatggttatcatgagaag
gaaagacactttatgaagatctatctttacaatcctacaatggtgaaaaggatatgtgaa
cttttgcaaagcggagccataatgaataaattttaccagcctcatgaagcgcatattccc
tacctcctacagctcttcattgactacaatctttatggcatgaatttaataaatctggct
gctgtcaagttccgaaaagcaagaaggaaaagtaatacattgcatgcaactggatcctgc
aagaatcatttatcaggaaattctcttgctgatactttatttcggtgggaacaagatgaa
ataccaagctctttaatattggaaggtgttgaaccacagagtacatgtgaattagaagtg
gatgctgtagctgctgatatcttaaatcgtctggacattgaagctcaaattggtggaaac
cctggtctacaggccatatgggaagatgaaaagcaacggcgaagaaacagaaatgaaact
tctcaaatgagccaacctgagtcacaagatcacaggtttgtgccagcaacagaaagtgaa
aaaaaatttcagaagagacttcaggaaattctcaaacagaatgatttctctgtaacatta
tcaggatctgtggactacagcgatggatcccaggagttctctgctgagttaacattgcac
tctgaggttctgtctcctgaaatgcttcagtgtacaccagccaatatggtagaagttcac
aaagacaaagagtcaagcaaaggtcacactagacacaaagtggaagaagctcttattaat
gaagaagcaattttgaaccttatggaaaatagtcagacttttcagcctttgacccaaaga
ctgagtgagtcacctgttttcatggacagtagtcctgatgaggctctggtacatcttctt
gctggtttggaaagtgatggatatcggggggaaagaaataggatgccatcaccatgtcgc
tcctttggaaataataaatatccacaaaatagtgatgatgaagaaaatgaaccacagatt
gaaaaagaggaaatggagcttagtttggtgatgtcccagagatgggacagcaatattgaa
gaacattgtgccaaaaagagatcactgtgcagaaatacccacagaagttcaactgaagat
gatgactcatcttcaggagaagaaatggaatggagtgataacagtttgcttctagccagt
ctttctatacctcagttagatggaactgcagatgaaaatagtgacaatccattgaacaat
gaaaattctagaacccactcttctgtaattgcaacaagcaagctttcagttaaaccctcc
atctttcacaaagatgctgctacattagaaccctcatcttctgctaagattacctttcag
tgtaaacacacaagtgccctttcttcccatgttttgaacaaggaagatttaattgaagac
ctttcacagacaaacaaaaatacagaaaaaggtctagataactcagtcacttcttttaca
aacgaaagcacttattctatgaaataccctggatctttaagcagtactgttcattcagaa
aattctcataaagagaatagtaagaaagagatcctcccagtatcttcctgtgaaagtagt
atttttgattatgaagaagatattccatctgttacaagacaagtaccaagtagaaaatat
acaaacattagaaaaatcgaaaaggattccccttttatacatatgcaccgtcaccctaac
gagaatacattgggcaaaaattctttcaacttttctgacttaaatcattcaaaaaataaa
gtatcctctgaaggaaatgaaaaaggaaacagcacagctctgagtagtttattcccttca
tcatttactgaaaattgtgaattactgtcatgctcaggggagaatagaactatggtgcat
tctcttaatagcactgctgatgaaagtggactaaataaacttaaaattaggtatgaagaa
tttcaagaacataaaacagaaaagccaagcctcagccagcaagcagcacactatatgttt
tttcccagtgttgttctttctaactgtcttactagaccacagaaactatctcctgtcaca
tataaattacaacctggcaataaaccatcccggttaaaattgaataaaaggaaacttgca
ggtcatcaggagacttctaccaaaagtagtgagactggatccacaaaagataattttata
caaaataatccttgtaatagtaatcctgagaaggataatgcattggctagtgatttaact
aaaaccactcgtggagcttttgaaaataaaacacccacagatggttttatagactgtcac
tttggagatggaacgttagaaactgagcagtcctttggactatatggaaataaatacaca
cttagagccaaacgcaaggtaaattatgagactgaagacagtgagtcaagttttgtaact
cacaactcaaaaattagtctacctcatcccatggaaattggtgaaagtttagatggaact
ctcaaatcccgaaaacgaagaaaaatgtctaaaaagctgccccctgtcatcataaagtat
attattattaatagatttagagggagaaaaaatatgcttgtgaagctaggaaaaatagac
tctaaagaaaaacaagtaatattaacagaagaaaaaatggaactatataaaaagcttgca
cctttgaaggacttttggccaaaagttcccgactcccctgcaaccaaatatcccatttat
ccactaacaccaaagaaaagtcacagaagaaagtcaaaacataaatctgctaagaaaaaa
actggtaaacaacaaaggacaaataatgaaaatattaaaagaactttgtctttcaggaaa
aaacggtcacatgctattctttctcctccctcaccatcttacaatgctgaaaccgaagat
tgtgacctgaattatagtgatgttatgtctaaactaggttttctttctgagagaagcaca
agtcccataaattcttctccacctcgctgctggtctcccacagatccaagagctgaagaa
atcatggctgctgcagaaaaagaggcaatgctttttaagggtcctaatgtatataagaag
actgttaattctcgtataggaaaaactagtcgcgcaagagcacagattaagaaatcaaaa
gcaaagcttgctaatccctctatagttactaagaaaaggaacaaacgaaatcagacaaat
aaactagtagatgatggaaaaaagaaaccaagagcaaaacaaaaaacaaatgagaaaggt
acatcgagaaagcatacaacacttaaggatgaaaaaataaaatctcagtctggtgctgag
gttaagtttgtactgaaacaccagaatgtgtctgaatttgcaagtagttctggaggctct
caactactttttaaacagaaagatatgccactaatgggctctgctgtagatcatcccctt
tctgcttccctacccactggaattaatgcacaacagaagttatctggctgcttttcttct
ttcttagaaagcaagaagtctgtagatttgcagacattccccagttcacgagatgatttg
catccatcagttgtttgtaattctataggacctggagtctcaaaaattaatgttcaaagg
cctcataatcaaagtgctatgtttactctaaaggaatcaacgttaattcaaaaaaatata
tttgacctttccaatcatttatctcaggtagcacagaatacacagatatcttctggtatg
tcctcaaagatagaagataatgcaaataatatacaaagaaactatttgtcatcaatcgga
aagttaagtgaatatcgcaattccctagaatcaaagctggaccaagcatatacccctaat
tttttgcattgcaaagacagtcagcagcagattgtgtgcatagcggaacagtcaaagcac
agtgaaacttgttctccgggaaatacagcttcagaggaaagccaaatgcctaataattgc
tttgtaacttccttgagaagtccaatcaaacaaatagcatgggagcaaaagcaaaggggc
tttattttagatatgtcaaattttaaacctgaaagagtaaaaccgaggtcgttatcagaa
gcaatttcacaaaccaaagcactttctcagtgtaaaaatcgaaatgtgtcaacaccttca
gcatttggtgaaggacagtctggactggcagttctaaaagaattgttacaaaaaagacag
cagaaagcacaaaatgcaaatactacacaagacccattatccaataaacatcaaccaaat
aaaaatatttctggttcccttgagcataacaaagcaaataaacggacacgatcggtaacg
tccccaagaaaacctcgaactcccagaagtacaaaacaaaaagaaaaaatccccaaactt
ctcaaagtagactctttaaatttacaaaactctagccagttggataactctgtatcagat
gatagtcccatctttttttcagatccaggctttgaaagttgttactcacttgaagatagt
ttatctcctgaacataattataattttgatattaacacaataggtcagactggattttgt
agcttttattctggaagtcagtttgtcccagctgatcagaatttgcctcagaagttccta
agtgatgctgttcaggatctttttccaggacaagctatagaaaaaaatgagtttttaagt
catgacaaccagaaatgtgatgaagacaagcatcataccacagactcagcctcatggatt
agatctggtactttaagtcctgaaatttttgagaagtcaaccatagatagcaatgagaat
cgtcgccacaaccagtggaaaaatagctttcatcctctaacaactcggtctaactcaata
atggattctttctgtgttcagcaggcagaagactgtctaagtgaaaaatctagattgaat
aggagttcagtaagcaaagaagtgtttcttagcctcccacagccaaacaattcagactgg
attcaaggtcacaccagaaaagaaatgggacagtctcttgactcagccaatacctctttt
actgcaatactctcctcccctgatggtgaacttgtagacgtggcctgtgaagatttagaa
ctgtatgtttcaagaaacaatgatatgttgacaccaactcctgatagttcaccaagatct
actagctctccttcacaatctaaaaatggcagcttcacccctcgaactgctaacattctg
aaaccacttatgtcccccccaagtagggaagaaattatggcaactttgttggatcatgac
ctgtctgagactatttaccaggaaccattttgcagtaatccttctgatgtaccagaaaag
cccagggagattggtggacggctcctcatggtagaaactcgacttgcaaatgatctggct
gagtttgagggagacttttccttggaaggacttcgtctttggaaaacagcattctcagca
atgactcagaatccaaggccagggtcaccccttcgcagtggccaaggagttgtcaataaa
gggtcaagtaatagccctaagatggttgaagataaaaaaattgtgattatgccttgcaaa
tgtgccccaagtcgacaactggttcaagtgtggcttcaagccaaagaagaatacgaacgt
tccaagaaactgcctaaaaccaagccaactggagttgtaaaatctgctgagaactttagc
tcttcagttaacccagatgacaaacctgtagtgcctccaaaaatggatgtaagtccatgt
atactccccactacagcacataccaaggaggatgttgataattctcagattgctttacaa
gcaccaaccacgggatgtagtcaaactgcaagtgaaagtcagatgctgccaccagttgcc
tctgcaagtgatcccgaaaaagatgaagatgatgatgataactattacattagttatagc
tcccctgattctccagtaattcccccttggcaacaaccaatatccccagattccaaagca
ttaaatggagatgatagaccctcatcaccagtagaggagctgccttcattggcttttgag
aacttcttaaagccaataaaagatggtatacaaaaaagcccctgcagtgagcctcaagag
cctctagtgatatctccaattaatactagggcaagaactgggaaatgtgaatcactttgc
tttcatagtacaccaatcatacagagaaaacttctggaaaggcttcctgaagcacctggc
cttagcccattatcaacagaaccaaaaacacagaagttgagtaataagaaaggaagtaat
actgacactcttagaagagtactgttaacacaagcaaagaatcaatttgcagcagtaaat
accccacagaaagaaacttctcagattgatggaccatctttaaacaatacttacggtttc
aaagtcagcatacaaaacttacaggaggcaaaagctttacatgagatacaaaatcttacc
ctaatcagtgtggagttgcatgctcgaactagacgagacttagaaccggatcctgaattt
gacccaatctgtgctctgttctactgcatctcatctgacactccactgccagatacagaa
aaaacagaactcacaggtgtaatagtgattgataaagacaagacagttttcagtcaagat
atcagatatcagactccattacttattagatctggaattacaggactcgaagtcacctat
gctgctgatgagaaggcactttttcatgaaattgcaaatataataaagaggtatgatcct
gatattctgctaggatatgagattcagatgcattcctggggttacctcttacaaagggct
gccgctttaagtattgacttatgtcggatgatctctcgggtgccagatgacaaaattgag
aacagatttgcagctgaaagagatgagtatggatcatatacaatgagtgagataaatatt
gttggccgaattacactaaatctttggagaatcatgagaaatgaggtggctctaactaac
tacacctttgaaaatgtgagctttcatgttcttcatcagcgttttcccctctttaccttt
cgagtcttgtcagactggtttgataacaagacagatctatacagatggaaaatggttgat
cattatgttagccgtgtccgtggaaatctccaaatgttagaacagctggacctgattggg
aaaaccagtgagatggctagactttttggcattcagtttttacatgtactgacaaggggt
tcacagtaccgtgtggaatcaatgatgttgcgtattgctaaaccaatgaactatattcct
gtgacacctagtgttcagcaaagatcccagatgagagccccacagtgtgttcctctaatt
atggagcctgaatcccgcttctatagcaactctgttctcgttttggatttccaatcactt
tatccttctattgtgattgcatataactactgcttttccacctgccttggccatgtggag
aacttgggaaagtatgatgagttcaaatttggctgtacctctctgagagtacctccagat
ttactttaccaagttaggcatgatatcacagtgtcccccaatggagtagcttttgtcaag
ccttcagtaagaaaaggtgtactaccaagaatgcttgaagaaattttgaagactagattt
atggtgaagcagtcaatgaaggcttacaagcaagacagagccctgtcacgaatgcttgat
gcgcgtcagttgggacttaagctgatagcaaatgtcacatttggctatacatctgctaat
ttttctgggagaatgccatgcattgaggttggcgatagtattgttcacaaagccagagag
accttggaacgagctattaaactggtgaatgataccaagaaatggggggctagggttgta
tatggcgatactgacagtatgtttgtgctactgaaaggagccactaaggagcagtctttt
aagattggtcaggaaattgccgaagctgtaactgctaccaatcctaaaccagtgaaattg
aagtttgaaaaggtatatttgccctgtgttttacaaacaaaaaagaggtatgtgggttac
atgtatgaaacactggatcagaaggacccagtatttgatgcaaaaggaatagaaacagtc
agaagagattcctgccctgctgtttctaagatacttgagcgttctctaaagctgctattt
gaaacgagagatataagtctaattaaacagtatgttcagcgacaatgtatgaagcttctg
gaaggaaaggccagcatacaagactttatctttgccaaggaatacagaggaagtttttct
tataaaccaggagcttgtgtgccagcccttgaacttacaaggaaaatgctgacttatgac
cggcgctctgagcctcaggttggggagcgagtgccatacgtcatcatttatgggaccccc
ggagtaccacttatccagcttgtaaggcgcccagtggaagtcctgcaggacccaactctg
agactgaatgctacttactatattaccaagcaaatccttccacccttggcaagaatcttc
tcacttattggtattgatgtcttcagctggtatcatgaattaccaaggatccataaagct
accagctcctcgcgaagtgaacctgaagggcggaaaggcactatttcacaatattttact
accttacactgtcctgtgtgtgatgacctaactcagcatggcatctgtagtaaatgtcgg
agccaacctcagcatgttgcagtcatcctcaaccaagaaatccgggagttggaacgtcaa
caggagcaacttgtaaagatatgcaagaactgtacaggttgctttgatcgacacatccca
tgtgtttctctgaactgcccagtacttttcaaactctcccgagtaaatagagaattgtcc
aaggcaccatatctccggcagttattagaccagttttaa

DBGET integrated database retrieval system