KEGG   Homo sapiens (human): 5981Help
Entry
5981              CDS       T01001                                 

Gene name
RFC1, A1, MHCBFB, PO-GA, RECC1, RFC, RFC140
Definition
replication factor C (activator 1) 1, 145kDa
Orthology
K10754  
replication factor C subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Module
RF-C complex
BRCA1-associated genome surveillance complex (BASC)
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:hsa03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:hsa03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:hsa03430]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4p14-p13
AA seq 1148 aa AA seqDB search
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPS
KKKRIIYDSDSESEETLQVKNAKKPPEKLPVSSKPGKISRQDPVTYISETDEEDDFMCKK
AASKSKENGRSTNSHLGTSNMKKNEENTKTKNKPLSPIKLTPTSVLDYFGTGSVQRSNKK
MVASKRKELSQNTDESGLNDEAIAKQLQLDEDAELERQLHEDEEFARTLAMLDEEPKTKK
ARKDTEAGETFSSVQANLSKAEKHKYPHKVKTAQVSDERKSYSPRKQSKYESSKESQQHS
KSSADKIGEVSSPKASSKLAIMKRKEESSYKEIEPVASKRKENAIKLKGETKTPKKTKSS
PAKKESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLIFVITGVLES
IERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIR
TMPGKKSKYEIAVETEMKKESKLERTPQKNVQGKRKISPSKKESESKKSRPTSKRDSLAK
TIKKETDVFWKSLDFKEQVAEETSGDSKARNLADDSSENKVENLLWVDKYKPTSLKTIIG
QQGDQSCANKLLRWLRNWQKSSSEDKKHAAKFGKFSGKDDGSSFKAALLSGPPGVGKTTT
ASLVCQELGYSYVELNASDTRSKSSLKAIVAESLNNTSIKGFYSNGAASSVSTKHALIMD
EVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQI
KGAMMSIAFKEGLKIPPPAMNEIILGANQDIRQVLHNLSMWCARSKALTYDQAKADSHRA
KKDIKMGPFDVARKVFAAGEETAHMSLVDKSDLFFHDYSIAPLFVQENYIHVKPVAAGGD
MKKHLMLLSRAADSICDGDLVDSQIRSKQNWSLLPAQAIYASVLPGELMRGYMTQFPTFP
SWLGKHSSTGKHDRIVQDLALHMSLRTYSSKRTVNMDYLSLLRDALVQPLTSQGVDGVQD
VVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAI
KASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAIETDAMIKKKTKSSKPSKPEKDKEPRK
GKGKSSKK
NT seq 3447 nt NT seq  +upstreamnt  +downstreamnt
atggacattcggaaattctttggagtaataccaagtggaaagaaacttgtaagtgaaaca
gtaaagaagaatgagaaaacaaagtctgatgaagaaactttaaaagcaaagaaaggaata
aaggaaatcaaggtaaatagctcccgtaaagaggatgacttcaaacaaaagcaaccaagc
aagaaaaagaggatcatctatgattcagattcagagtcagaggagacgttgcaggtaaaa
aatgccaaaaagccaccagaaaaactgccagtatcttctaaacctggtaaaatttcacgg
caggatcctgttacatacatttcagaaacagatgaagaagatgactttatgtgtaagaag
gcggcctctaaatcaaaagagaatggaagatctacaaatagtcatcttggaacatcaaac
atgaaaaagaatgaagaaaacactaagaccaagaataagcctttatcaccaataaaactt
acacccacatcagtacttgattattttggaactggaagtgtccaaagatctaataagaag
atggtggcaagcaaaagaaaagagctttcacaaaatacagatgagtctggattaaatgat
gaagccatcgccaagcaattacagcttgatgaagatgcggagctggagaggcagttgcat
gaagatgaagagtttgccagaacattagccatgttggatgaagaacccaagaccaaaaag
gctcgaaaggacacagaagcgggagaaacgttttcatctgtccaagccaatttaagtaaa
gcagaaaaacataaatatcctcataaagtaaaaacagcacaagtttcagatgaaagaaag
agctacagtcctaggaagcaaagtaaatatgaaagttcaaaagaatctcagcaacattcc
aagtcatcagctgacaaaataggagaagtctcttctcccaaggccagttctaagctggca
attatgaaaagaaaagaagagagctcttataaagaaatagagcctgtggcctcaaaaaga
aaagaaaatgccattaaattgaaaggagagacaaaaactcctaagaaaaccaaaagttct
ccagctaaaaaagagtctgtaagtcctgaagattctgaaaagaaacgcactaattatcaa
gcttatcgaagctacttaaatcgagaaggtcccaaggctctgggctccaaagaaatacca
aagggagctgaaaattgcttggaaggccttatatttgtaatcacaggcgtgctggagtct
attgaacgagatgaggccaagtctctaattgaacgttatgggggaaaagtaacaggaaat
gtcagcaagaaaacaaattatcttgtcatgggtcgtgatagtggacagtccaagagtgat
aaggccgcagccttggggacaaaaattattgatgaagatggcctgttgaatctgattcgg
actatgccaggcaagaaatccaagtatgaaatagcagttgaaactgagatgaagaaagag
tccaaactggagagaacaccccaaaaaaatgtccaaggaaaaagaaaaattagtccatct
aaaaaggaatcagaatctaaaaagagcaggccgacttccaaaagggacagtttggcaaag
acaataaaaaaggaaacagatgtgttttggaaaagcctggatttcaaggagcaggtggct
gaggagacaagtggtgacagcaaggctaggaatttggctgatgacagcagtgaaaacaaa
gtggaaaatttgctctgggtggataaatataagccaacctcgctcaagaccataattgga
cagcaaggtgaccagagctgtgccaacaaactcctacgctggctccgaaactggcaaaag
agttcttccgaagataaaaaacacgcagcaaagtttggtaaattttccggcaaagatgat
ggctctagttttaaagcagcgttgctgtcaggccctcctggtgttggcaaaaccaccaca
gcttccctggtgtgtcaggagttgggatacagctacgtggaactgaatgcaagtgacacc
cggagtaagagcagtttgaaggcgattgttgctgagtcactgaacaataccagcatcaaa
ggcttttattcaaatggagcagcctcttcagtaagcacgaaacatgctctcatcatggat
gaagtagatggcatggcaggcaatgaggataggggaggaattcaggaattaattggcctg
ataaaacatactaaaattcccattatttgtatgtgcaatgatagaaatcatcccaagatt
cgctctctggttcattattgttttgatcttcgttttcaaagacctcgggttgaacagatt
aagggtgctatgatgtctattgcatttaaagaaggtttaaagattccccctccagctatg
aatgaaataattttgggagccaatcaagatatcagacaggttttacataatctgagtatg
tggtgtgcacgaagtaaagcattaacctatgaccaggccaaagctgattctcacagagcc
aaaaaggatatcaaaatgggcccatttgatgttgcccggaaagtgtttgcagctggagag
gagactgctcacatgtcacttgtggacaagtcagatctcttttttcatgattattcaata
gcacccctcttcgtccaggaaaattacatacacgtgaagcctgtagcagcagggggtgac
atgaaaaagcacctgatgcttttaagcagagcagcagacagcatatgcgatggtgaccta
gtggacagccagatccggagtaagcaaaactggagtcttctgcctgcgcaggccatttat
gccagtgttcttcctggagagttgatgagggggtacatgacccagtttcccaccttccca
agctggctggggaagcactcgtctacaggcaaacatgatcgtattgttcaggacctggcc
ttgcatatgagtctcagaacttactccagcaaaaggactgtaaacatggattatctgtcg
cttctaagggatgcacttgtacagcccttgacctcacaaggagtagacggagtacaggat
gttgttgcacttatggacacatattatttgatgaaagaagactttgagaatatcatggaa
atcagcagctggggtggcaaacctagtcccttttcaaagctggatcccaaggtgaaagca
gccttcacaagagcttacaataaggaagcccaccttactccatactcacttcaagctata
aaggcatctagacacagcacaagcccatccctggattcggaatacaatgaagaattaaat
gaagatgactctcaatctgatgagaaagaccaagatgctatagaaactgatgccatgatc
aagaaaaagacaaaatcttcaaagccttcaaaaccagaaaaagataaggagcccagaaaa
ggaaaaggaaaaagttcgaagaaatga

DBGET integrated database retrieval system