KEGG   Homo sapiens (human): 5981Help
Entry
5981              CDS       T01001                                 

Gene name
RFC1, A1, MHCBFB, PO-GA, RECC1, RFC, RFC140
Definition
replication factor C (activator 1) 1, 145kDa
Orthology
K10754  
replication factor C subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Module
RF-C complex
BRCA1-associated genome surveillance complex (BASC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    5981 (RFC1)
   03420 Nucleotide excision repair
    5981 (RFC1)
   03430 Mismatch repair
    5981 (RFC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4p14-p13
AA seq 1148 aa AA seqDB search
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPS
KKKRIIYDSDSESEETLQVKNAKKPPEKLPVSSKPGKISRQDPVTYISETDEEDDFMCKK
AASKSKENGRSTNSHLGTSNMKKNEENTKTKNKPLSPIKLTPTSVLDYFGTGSVQRSNKK
MVASKRKELSQNTDESGLNDEAIAKQLQLDEDAELERQLHEDEEFARTLAMLDEEPKTKK
ARKDTEAGETFSSVQANLSKAEKHKYPHKVKTAQVSDERKSYSPRKQSKYESSKESQQHS
KSSADKIGEVSSPKASSKLAIMKRKEESSYKEIEPVASKRKENAIKLKGETKTPKKTKSS
PAKKESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLIFVITGVLES
IERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIR
TMPGKKSKYEIAVETEMKKESKLERTPQKNVQGKRKISPSKKESESKKSRPTSKRDSLAK
TIKKETDVFWKSLDFKEQVAEETSGDSKARNLADDSSENKVENLLWVDKYKPTSLKTIIG
QQGDQSCANKLLRWLRNWQKSSSEDKKHAAKFGKFSGKDDGSSFKAALLSGPPGVGKTTT
ASLVCQELGYSYVELNASDTRSKSSLKAIVAESLNNTSIKGFYSNGAASSVSTKHALIMD
EVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQI
KGAMMSIAFKEGLKIPPPAMNEIILGANQDIRQVLHNLSMWCARSKALTYDQAKADSHRA
KKDIKMGPFDVARKVFAAGEETAHMSLVDKSDLFFHDYSIAPLFVQENYIHVKPVAAGGD
MKKHLMLLSRAADSICDGDLVDSQIRSKQNWSLLPAQAIYASVLPGELMRGYMTQFPTFP
SWLGKHSSTGKHDRIVQDLALHMSLRTYSSKRTVNMDYLSLLRDALVQPLTSQGVDGVQD
VVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAI
KASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAIETDAMIKKKTKSSKPSKPEKDKEPRK
GKGKSSKK
NT seq 3447 nt NT seq  +upstreamnt  +downstreamnt
atggacattcggaaattctttggagtaataccaagtggaaagaaacttgtaagtgaaaca
gtaaagaagaatgagaaaacaaagtctgatgaagaaactttaaaagcaaagaaaggaata
aaggaaatcaaggtaaatagctcccgtaaagaggatgacttcaaacaaaagcaaccaagc
aagaaaaagaggatcatctatgattcagattcagagtcagaggagacgttgcaggtaaaa
aatgccaaaaagccaccagaaaaactgccagtatcttctaaacctggtaaaatttcacgg
caggatcctgttacatacatttcagaaacagatgaagaagatgactttatgtgtaagaag
gcggcctctaaatcaaaagagaatggaagatctacaaatagtcatcttggaacatcaaac
atgaaaaagaatgaagaaaacactaagaccaagaataagcctttatcaccaataaaactt
acacccacatcagtacttgattattttggaactggaagtgtccaaagatctaataagaag
atggtggcaagcaaaagaaaagagctttcacaaaatacagatgagtctggattaaatgat
gaagccatcgccaagcaattacagcttgatgaagatgcggagctggagaggcagttgcat
gaagatgaagagtttgccagaacattagccatgttggatgaagaacccaagaccaaaaag
gctcgaaaggacacagaagcgggagaaacgttttcatctgtccaagccaatttaagtaaa
gcagaaaaacataaatatcctcataaagtaaaaacagcacaagtttcagatgaaagaaag
agctacagtcctaggaagcaaagtaaatatgaaagttcaaaagaatctcagcaacattcc
aagtcatcagctgacaaaataggagaagtctcttctcccaaggccagttctaagctggca
attatgaaaagaaaagaagagagctcttataaagaaatagagcctgtggcctcaaaaaga
aaagaaaatgccattaaattgaaaggagagacaaaaactcctaagaaaaccaaaagttct
ccagctaaaaaagagtctgtaagtcctgaagattctgaaaagaaacgcactaattatcaa
gcttatcgaagctacttaaatcgagaaggtcccaaggctctgggctccaaagaaatacca
aagggagctgaaaattgcttggaaggccttatatttgtaatcacaggcgtgctggagtct
attgaacgagatgaggccaagtctctaattgaacgttatgggggaaaagtaacaggaaat
gtcagcaagaaaacaaattatcttgtcatgggtcgtgatagtggacagtccaagagtgat
aaggccgcagccttggggacaaaaattattgatgaagatggcctgttgaatctgattcgg
actatgccaggcaagaaatccaagtatgaaatagcagttgaaactgagatgaagaaagag
tccaaactggagagaacaccccaaaaaaatgtccaaggaaaaagaaaaattagtccatct
aaaaaggaatcagaatctaaaaagagcaggccgacttccaaaagggacagtttggcaaag
acaataaaaaaggaaacagatgtgttttggaaaagcctggatttcaaggagcaggtggct
gaggagacaagtggtgacagcaaggctaggaatttggctgatgacagcagtgaaaacaaa
gtggaaaatttgctctgggtggataaatataagccaacctcgctcaagaccataattgga
cagcaaggtgaccagagctgtgccaacaaactcctacgctggctccgaaactggcaaaag
agttcttccgaagataaaaaacacgcagcaaagtttggtaaattttccggcaaagatgat
ggctctagttttaaagcagcgttgctgtcaggccctcctggtgttggcaaaaccaccaca
gcttccctggtgtgtcaggagttgggatacagctacgtggaactgaatgcaagtgacacc
cggagtaagagcagtttgaaggcgattgttgctgagtcactgaacaataccagcatcaaa
ggcttttattcaaatggagcagcctcttcagtaagcacgaaacatgctctcatcatggat
gaagtagatggcatggcaggcaatgaggataggggaggaattcaggaattaattggcctg
ataaaacatactaaaattcccattatttgtatgtgcaatgatagaaatcatcccaagatt
cgctctctggttcattattgttttgatcttcgttttcaaagacctcgggttgaacagatt
aagggtgctatgatgtctattgcatttaaagaaggtttaaagattccccctccagctatg
aatgaaataattttgggagccaatcaagatatcagacaggttttacataatctgagtatg
tggtgtgcacgaagtaaagcattaacctatgaccaggccaaagctgattctcacagagcc
aaaaaggatatcaaaatgggcccatttgatgttgcccggaaagtgtttgcagctggagag
gagactgctcacatgtcacttgtggacaagtcagatctcttttttcatgattattcaata
gcacccctcttcgtccaggaaaattacatacacgtgaagcctgtagcagcagggggtgac
atgaaaaagcacctgatgcttttaagcagagcagcagacagcatatgcgatggtgaccta
gtggacagccagatccggagtaagcaaaactggagtcttctgcctgcgcaggccatttat
gccagtgttcttcctggagagttgatgagggggtacatgacccagtttcccaccttccca
agctggctggggaagcactcgtctacaggcaaacatgatcgtattgttcaggacctggcc
ttgcatatgagtctcagaacttactccagcaaaaggactgtaaacatggattatctgtcg
cttctaagggatgcacttgtacagcccttgacctcacaaggagtagacggagtacaggat
gttgttgcacttatggacacatattatttgatgaaagaagactttgagaatatcatggaa
atcagcagctggggtggcaaacctagtcccttttcaaagctggatcccaaggtgaaagca
gccttcacaagagcttacaataaggaagcccaccttactccatactcacttcaagctata
aaggcatctagacacagcacaagcccatccctggattcggaatacaatgaagaattaaat
gaagatgactctcaatctgatgagaaagaccaagatgctatagaaactgatgccatgatc
aagaaaaagacaaaatcttcaaagccttcaaaaccagaaaaagataaggagcccagaaaa
ggaaaaggaaaaagttcgaagaaatga

DBGET integrated database retrieval system