KEGG   Homo sapiens (human): 5983Help
Entry
5983              CDS       T01001                                 

Gene name
RFC3, RFC38
Definition
(RefSeq) replication factor C subunit 3
  KO
K10756  
replication factor C subunit 3/5
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Module
RF-C complex
BRCA1-associated genome surveillance complex (BASC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    5983 (RFC3)
   03420 Nucleotide excision repair
    5983 (RFC3)
   03430 Mismatch repair
    5983 (RFC3)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    5983 (RFC3)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     5983 (RFC3)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    5983 (RFC3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    RFC (replication factor C)
     5983 (RFC3)
  Check point factors
   HRAD17(Rad24)-RFC complex
    5983 (RFC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P40938(Tbio)
UniProt: 
Position
13q13.2
AA seq 356 aa AA seqDB search
MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELY
GVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQ
LETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCL
AVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPF
TADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELL
HNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagcctctgggtggacaagtatcggccctgctccttgggacggctggactatcacaag
gagcaggcggcccagctgcggaacctggtgcagtgtggtgactttcctcatctgttagtg
tacggaccatcaggtgctggaaaaaagacaagaattatgtgtattctacgtgaactttat
ggtgttggagtggaaaaattgagaattgaacatcagaccatcacaactccatctaaaaaa
aaaattgaaattagcaccattgcaagtaactaccaccttgaagttaatcctagtgatgct
ggaaatagtgaccgagtagtcattcaggagatgttgaaaacagtggcacaatcacaacaa
cttgaaacaaactctcaaagggattttaaagtggtattattgacagaagttgacaaactc
accaaagatgctcagcatgccttgcgaagaaccatggaaaaatatatgtctacctgcaga
ttgatcttgtgctgcaattctacatctaaagtgatcccacctattcgtagtaggtgcttg
gcggttcgtgtgcctgctcccagcattgaagatatttgccacgtgttatctactgtgtgt
aagaaggaaggtctgaatcttccttcacaactggctcatagacttgcagagaagtcttgt
agaaatctcagaaaagccctgcttatgtgtgaagcctgcagagtgcaacaatatcctttt
actgcagatcaagaaatccctgagacagattgggaggtgtatctgagggagactgcaaat
gctattgtcagtcagcaaactccacaaaggctccttgaagttcgtggaaggctgtatgag
cttctaactcattgtattcctcctgagataataatgaagggccttctctcagaactgtta
cataattgtgatggacaactgaaaggggaggtggcacaaatggcagcttactatgagcat
cgtctacagctgggtagcaaagccatttatcacttggaagcgtttgtggccaaattcatg
gcactttataagaagttcatggaggatggattggaaggcatgatgttctga

DBGET integrated database retrieval system