KEGG   Homo sapiens (human): 5984Help
Entry
5984              CDS       T01001                                 

Gene name
RFC4, A1, RFC37
Definition
replication factor C (activator 1) 4, 37kDa
Orthology
K10755  
replication factor C subunit 2/4
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Module
RF-C complex
BRCA1-associated genome surveillance complex (BASC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    5984 (RFC4)
   03420 Nucleotide excision repair
    5984 (RFC4)
   03430 Mismatch repair
    5984 (RFC4)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     5984 (RFC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q27
AA seq 363 aa AA seqDB search
MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVA
VLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVR
EKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLIC
NYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRK
AITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEG
HAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLS
QNC
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcatttcttaaaggtacatccatcagtactaaacccccgctgaccaaggatcga
ggagtagctgccagtgcgggaagtagcggagagaacaagaaagccaaacccgttccctgg
gtggaaaaatatcgcccaaaatgtgtggatgaagttgctttccaggaagaagtggttgca
gtgctgaaaaaatctttagaaggagcagatcttcctaatctcttgttttacggaccacct
ggaactggaaaaacatccactattttggcagcagctagagaactctttgggcctgaactt
ttccgattaagagttcttgagttaaatgcatctgatgaacgtggaatacaagtagttcga
gagaaagtgaaaaattttgctcaattaactgtgtcaggaagtcgctcagatgggaagccg
tgtccgccttttaagattgtgattctggatgaagcagattctatgacctcagctgctcag
gcagctttaagacgtaccatggagaaggagtcgaaaaccacccgattctgtcttatctgt
aactatgtcagtcgaataattgaacccctgacctctagatgttcaaaattccgcttcaag
cctctgtcagataaaattcaacagcagcgattactagacattgccaagaaggaaaatgtc
aaaattagtgatgagggaatagcttatcttgttaaagtgtcagaaggagacttaagaaaa
gccattacatttcttcaaagcgctactcgattaacaggtggaaaggagatcacagagaaa
gtgattacagacattgccggggtaataccagctgagaaaattgatggagtatttgctgcc
tgtcagagtggctcttttgacaaactagaagctgtggtcaaggatttaatagatgagggt
catgcagcaactcagctcgtcaatcaactccatgatgtggttgtagaaaataacttatct
gataaacagaagtctattatcacagaaaaacttgccgaagttgacaaatgcctagcagat
ggtgctgatgaacatttgcaactcatcagcctttgtgcaactgtgatgcagcagttatct
cagaattgttaa

DBGET integrated database retrieval system