KEGG   Homo sapiens (human): 5994Help
Entry
5994              CDS       T01001                                 

Gene name
RFXAP
Definition
regulatory factor X-associated protein
Orthology
K08063  
regulatory factor X-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
Antigen processing and presentation
Tuberculosis
Primary immunodeficiency
Disease
H00093  
Combined immunodeficiencies (CIDs)
H00985  
Bare lymphocyte syndrome (BLS) type2
Class
Organismal Systems; Immune system; Antigen processing and presentation [PATH:hsa04612]
Human Diseases; Immune diseases; Primary immunodeficiency [PATH:hsa05340]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q14
AA seq 272 aa AA seqDB search
MEAQGVAEGAGPGAASGVPHPAALAPAAAPTLAPASVAAAASQFTLLVMQPCAGQDEAAA
PGGSVGAGKPVRYLCEGAGDGEEEAGEDEADLLDTSDPPGGGESAASLEDLEDEETHSGG
EGSSGGARRRGSGGGSMSKTCTYEGCSETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKSD
QALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLR
SPEVVQFLQKQQQLLNQQVLEQRQQQFPGTSM
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgcagggtgtagcggagggcgcggggccgggcgccgccagcggcgtgccccac
cccgcggccctagccccggctgcggctcccaccttggcgccagcctcggtggcggccgcg
gcctctcaattcaccctgctagtgatgcaaccctgtgctgggcaggacgaggctgcggcc
cccgggggcagcgttggggcgggcaagcccgttaggtacctgtgcgaaggggccggggat
ggcgaagaggaggctggggaggacgaggcggacctgttagacacttcggaccctccgggg
ggaggcgagagcgcggctagtttggaggatctagaggacgaggagactcactcggggggc
gagggcagcagcgggggcgcccggaggcggggcagcggtgggggcagcatgagcaagacc
tgcacctacgaaggctgcagcgagaccacgagccaggtggccaagcagcgcaaaccgtgg
atgtgcaagaaacaccgcaacaagatgtacaaggacaagtataaaaagaagaagagcgac
caggccctgaactgcggtgggactgcctcgactggcagcgcgggaaacgtcaaactcgag
gaaagtgcagataacatactctccattgttaaacaaagaacaggatcttttggggatcgt
cctgcaagacctactcttttagaacaagtgttaaatcaaaaaagactgtcgttactaaga
agtccagaagtagtgcaatttttacagaaacagcaacagctattaaatcagcaagttttg
gagcaaagacaacagcagtttccaggaacatcaatgtga

DBGET integrated database retrieval system