KEGG   Homo sapiens (human): 5997Help
Entry
5997              CDS       T01001                                 

Gene name
RGS2, G0S8
Definition
(RefSeq) regulator of G-protein signaling 2
  KO
K18154  
regulator of G-protein signaling 2
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Olfactory transduction
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    5997 (RGS2)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    5997 (RGS2)
  Sensory system
   04740 Olfactory transduction
    5997 (RGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q31
AA seq 211 aa AA seqDB search
MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKT
GKKSKQQAFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITTEPHAT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtgctatgttcttggctgttcaacacgactgcagacccatggacaagagcgca
ggcagtggccacaagagcgaggagaagcgagaaaagatgaaacggacccttttaaaagat
tggaagacccgtttgagctacttcttacaaaattcctctactcctgggaagcccaaaacc
ggcaaaaaaagcaaacagcaagctttcatcaagccttctcctgaggaagcacagctgtgg
tcagaagcatttgacgagctgctagccagcaaatatggtcttgctgcattcagggctttt
ttaaagtcggaattctgtgaagaaaatattgaattctggctggcctgtgaagacttcaaa
aaaaccaaatcaccccaaaagctgtcctcaaaagcaaggaaaatatatactgacttcata
gaaaaggaagctccaaaagagataaacatagattttcaaaccaaaactctgattgcccag
aatatacaagaagctacaagtggctgctttacaactgcccagaaaagggtatacagcttg
atggagaacaactcttatcctcgtttcttggagtcagaattctaccaggacttgtgtaaa
aagccacaaatcaccacagagcctcatgctacatga

DBGET integrated database retrieval system