KEGG   Homo sapiens (human): 5998Help
Entry
5998              CDS       T01001                                 

Gene name
RGS3, C2PA, RGP3
Definition
regulator of G-protein signaling 3
Orthology
K07524  
regulator of G-protein signalling 3
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    5998 (RGS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q32
AA seq 519 aa AA seqDB search
MFETEADEKREMALEEGKGPGAEDSPPSKEPSPGQELPPGQDLPPNKDSPSGQEPAPSQE
PLSSKDSATSEGSPPGPDAPPSKDVPPCQEPPPAQDLSPCQDLPAGQEPLPHQDPLLTKD
LPAIQESPTRDLPPCQDLPPSQVSLPAKALTEDTMSSGDLLAATGDPPAAPRPAFVIPEV
RLDSTYSQKAGAEQGCSGDEEDAEEAEEVEEGEEGEEDEDEDTSDDNYGERSEAKRSSMI
ETGQGAEGGLSLRVQNSLRRRTHSEGSLLQEPRGPCFASDTTLHCSDGEGAASTWGMPSP
STLKKELGRNGGSMHHLSLFFTGHRKMSGADTVGDDDEASRKRKSKNLAKDMKNKLGIFR
RRNESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEEN
LEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGC
FDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagacggaggcagatgagaagagggagatggccttggaggaagggaaggggcct
ggtgccgaggattccccacccagcaaggagccctctcctggccaggagcttcctccagga
caagaccttccacccaacaaggactccccttctgggcaggaacccgctcccagccaagaa
ccactgtccagcaaagactcagctacctctgaaggatcccctccaggcccagatgctccg
cccagcaaggatgtgccaccatgccaggaaccccctccagcccaagacctctcaccctgc
caggacctacctgctggtcaagaacccctgcctcaccaggaccctctactcaccaaagac
ctccctgccatccaggaatcccccacccgggaccttccaccctgtcaagatctgcctcct
agccaggtctccctgccagccaaggcccttactgaggacaccatgagctccggggaccta
ctagcagctactggggacccacctgcggcccccaggccagccttcgtgatccctgaggtc
cggctggatagcacctacagccagaaggcaggggcagagcagggctgctcgggagatgag
gaggatgcagaagaggccgaggaggtggaggagggggaggaaggggaggaggacgaggat
gaggacaccagcgatgacaactacggagagcgcagtgaggccaagcgcagcagcatgatc
gagacgggccagggggctgagggtggcctctcactgcgtgtgcagaactcgctgcggcgc
cggacgcacagcgagggcagcctgctgcaggagccccgagggccctgctttgcctccgac
accaccttgcactgctcagacggtgagggcgccgcctccacctggggcatgccttcgccc
agcaccctcaagaaagagctgggccgcaatggtggctccatgcaccacctttccctcttc
ttcacaggacacaggaagatgagcggggctgacaccgttggggatgatgacgaagcctcc
cggaagagaaagagcaaaaacctagccaaggacatgaagaacaagctggggatcttcaga
cggcggaatgagtcccctggagcccctcccgcgggcaaggcagacaaaatgatgaagtca
ttcaagcccacctcagaggaagccctcaagtggggcgagtccttggagaagctgctggtt
cacaaatacgggttagcagtgttccaagccttccttcgcactgagttcagtgaggagaat
ctggagttctggttggcttgtgaggacttcaagaaggtcaagtcacagtccaagatggca
tccaaggccaagaagatctttgctgaatacatcgcgatccaggcatgcaaggaggtcaac
ctggactcctacacgcgggagcacaccaaggacaacctgcagagcgtcacgcggggctgc
ttcgacctggcacagaagcgcatcttcgggctcatggaaaaggactcgtaccctcgcttt
ctccgttctgacctctacctggaccttattaaccagaagaagatgagtcccccgctttag

DBGET integrated database retrieval system