KEGG   Homo sapiens (human): 6004Help
Entry
6004              CDS       T01001                                 

Gene name
RGS16, A28-RGS14, A28-RGS14P, RGS-R
Definition
(RefSeq) regulator of G-protein signaling 16
  KO
K16449  
regulator of G-protein signaling
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q25-q31
AA seq 202 aa AA seqDB search
MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVL
GWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEE
FICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDL
AAQASAASATLSSCSLDEPSHT
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgcaccctggccgccttccccaccacctgcctggagagagccaaagagttcaag
acacgtctggggatctttcttcacaaatcagagctgggctgcgatactgggagtactggc
aagttcgagtggggcagtaaacacagcaaagagaatagaaacttctcagaagatgtgctg
gggtggagagagtcgttcgacctgctgctgagcagtaaaaatggagtggctgccttccac
gctttcctgaagacagagttcagtgaggagaacctggagttctggctggcctgtgaggag
ttcaagaagatccgatcagctaccaagctggcctccagggcacaccagatctttgaggag
ttcatttgcagtgaggcccctaaagaggtcaacattgaccatgagacccacgagctgacg
aggatgaacctgcagactgccacagccacatgctttgatgcggctcaggggaagacacgt
accctgatggagaaggactcctacccacgcttcctgaagtcgcctgcttaccgggacctg
gctgcccaagcctcagccgcctctgccactctgtccagctgcagcctggacgagccctca
cacacctga

DBGET integrated database retrieval system