KEGG   Homo sapiens (human): 6007Help
Entry
6007              CDS       T01001                                 

Gene name
RHD, CD240D, DIIIc, RH, RH30, RHCED, RHDVA(TT), RHDel, RHPII, RHXIII, Rh4, RhDCw, RhII, RhK562-II, RhPI
Definition
(RefSeq) Rh blood group D antigen
  KO
K06579  
Rhesus blood group glycoprotein
Organism
hsa  Homo sapiens (human)
Drug target
Rozrolimupab: 
Brite
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   6007 (RHD)
Cellular antigens [BR:hsa04090]
 Proteins
  6007 (RHD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.11
AA seq 417 aa AA seqDB search
MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAAI
GLGFLTSSFRRHSWSSVAFNLFMLALGVQWAILLDGFLSQFPSGKVVITLFSIRLATMSA
LSVLISVDAVLGKVNLAQLVVMVLVEVTALGNLRMVISNIFNTDYHMNMMHIYVFAAYFG
LSVAWCLPKPLPEGTEDKDQTATIPSLSAMLGALFLWMFWPSFNSALLRSPIERKNAVFN
TYYAVAVSVVTAISGSSLAHPQGKISKTYVHSAVLAGGVAVGTSCHLIPSPWLAMVLGLV
AGLISVGGAKYLPGCCNRVLGIPHSSIMGYNFSLLGLLGEIIYIVLLVLDTVGAGNGMIG
FQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHEAKYFDDQVFWKFPHLAVGF
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagctctaagtacccgcggtctgtccggcgctgcctgcccctctgggccctaacactg
gaagcagctctcattctcctcttctatttttttacccactatgacgcttccttagaggat
caaaaggggctcgtggcatcctatcaagttggccaagatctgaccgtgatggcggccatt
ggcttgggcttcctcacctcgagtttccggagacacagctggagcagtgtggccttcaac
ctcttcatgctggcgcttggtgtgcagtgggcaatcctgctggacggcttcctgagccag
ttcccttctgggaaggtggtcatcacactgttcagtattcggctggccaccatgagtgct
ttgtcggtgctgatctcagtggatgctgtcttggggaaggtcaacttggcgcagttggtg
gtgatggtgctggtggaggtgacagctttaggcaacctgaggatggtcatcagtaatatc
ttcaacacagactaccacatgaacatgatgcacatctacgtgttcgcagcctattttggg
ctgtctgtggcctggtgcctgccaaagcctctacccgagggaacggaggataaagatcag
acagcaacgatacccagtttgtctgccatgctgggcgccctcttcttgtggatgttctgg
ccaagtttcaactctgctctgctgagaagtccaatcgaaaggaagaatgccgtgttcaac
acctactatgctgtagcagtcagcgtggtgacagccatctcagggtcatccttggctcac
ccccaagggaagatcagcaagacttatgtgcacagtgcggtgttggcaggaggcgtggct
gtgggtacctcgtgtcacctgatcccttctccgtggcttgccatggtgctgggtcttgtg
gctgggctgatctccgtcgggggagccaagtacctgccggggtgttgtaaccgagtgctg
gggattccccacagctccatcatgggctacaacttcagcttgctgggtctgcttggagag
atcatctacattgtgctgctggtgcttgataccgtcggagccggcaatggcatgattggc
ttccaggtcctcctcagcattggggaactcagcttggccatcgtgatagctctcacgtct
ggtctcctgacaggtttgctcctaaatcttaaaatatggaaagcacctcatgaggctaaa
tattttgatgaccaagttttctggaagtttcctcatttggctgttggattttaa

DBGET integrated database retrieval system