KEGG   Homo sapiens (human): 6009Help
Entry
6009              CDS       T01001                                 

Gene name
RHEB, RHEB2
Definition
(RefSeq) Ras homolog enriched in brain
  KO
K07208  
Ras homolog enriched in brain
Organism
hsa  Homo sapiens (human)
Pathway
Phospholipase D signaling pathway
Autophagy - animal
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Insulin signaling pathway
Thyroid hormone signaling pathway
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    6009 (RHEB)
   04151 PI3K-Akt signaling pathway
    6009 (RHEB)
   04152 AMPK signaling pathway
    6009 (RHEB)
   04150 mTOR signaling pathway
    6009 (RHEB)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    6009 (RHEB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    6009 (RHEB)
   04919 Thyroid hormone signaling pathway
    6009 (RHEB)
  Aging
   04211 Longevity regulating pathway - mammal
    6009 (RHEB)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    6009 (RHEB)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Ras Family
   Rheb
    6009 (RHEB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q15382(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
7q36.1
AA seq 184 aa AA seqDB search
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSS
CSVM
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc
tcattgacgattcaatttgttgaaggccaatttgtggactcctacgatccaaccatagaa
aacacttttacaaagttgatcacagtaaatggacaagaatatcatcttcaacttgtagac
acagccgggcaagatgaatattctatctttcctcagacatactccatagatattaatggc
tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttatccat
ggcaaattgttggatatggtggggaaagtacaaatacctattatgttggttgggaataag
aaagacctgcatatggaaagggtgatcagttatgaagaagggaaagctttggcagaatct
tggaatgcagcttttttggaatcttctgctaaagaaaatcagactgctgtggatgttttt
cgaaggataattttggaggcagaaaaaatggacggggcagcttcacaaggcaagtcttca
tgctcggtgatgtga

DBGET integrated database retrieval system