KEGG   Homo sapiens (human): 6009Help
Entry
6009              CDS       T01001                                 

Gene name
RHEB, RHEB2
Definition
Ras homolog enriched in brain
Orthology
K07208  
Ras homolog enriched in brain
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Thyroid hormone signaling pathway
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:hsa04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q36
AA seq 184 aa AA seqDB search
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSS
CSVM
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc
tcattgacgattcaatttgttgaaggccaatttgtggactcctacgatccaaccatagaa
aacacttttacaaagttgatcacagtaaatggacaagaatatcatcttcaacttgtagac
acagccgggcaagatgaatattctatctttcctcagacatactccatagatattaatggc
tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttatccat
ggcaaattgttggatatggtggggaaagtacaaatacctattatgttggttgggaataag
aaagacctgcatatggaaagggtgatcagttatgaagaagggaaagctttggcagaatct
tggaatgcagcttttttggaatcttctgctaaagaaaatcagactgctgtggatgttttt
cgaaggataattttggaggcagaaaaaatggacggggcagcttcacaaggcaagtcttca
tgctcggtgatgtga

DBGET integrated database retrieval system