KEGG   Homo sapiens (human): 6009Help
Entry
6009              CDS       T01001                                 

Gene name
RHEB, RHEB2
Definition
(RefSeq) Ras homolog, mTORC1 binding
  KO
K07208  Ras homolog enriched in brain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04218  Cellular senescence
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05165  Human papillomavirus infection
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    6009 (RHEB)
   04151 PI3K-Akt signaling pathway
    6009 (RHEB)
   04152 AMPK signaling pathway
    6009 (RHEB)
   04150 mTOR signaling pathway
    6009 (RHEB)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    6009 (RHEB)
  Cell growth and death
   04218 Cellular senescence
    6009 (RHEB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    6009 (RHEB)
   04919 Thyroid hormone signaling pathway
    6009 (RHEB)
  Aging
   04211 Longevity regulating pathway - mammal
    6009 (RHEB)
  Environmental adaptation
   04714 Thermogenesis
    6009 (RHEB)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    6009 (RHEB)
  Infectious diseases
   05165 Human papillomavirus infection
    6009 (RHEB)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Ras Family
   Rheb
    6009 (RHEB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB
Motif
Other DBs
NCBI-GeneID: 6009
NCBI-ProteinID: NP_005605
OMIM: 601293
HGNC: 10011
Ensembl: ENSG00000106615
Vega: OTTHUMG00000157330
Pharos: Q15382(Tbio)
UniProt: Q15382 A0A090N900
Structure
PDB: 

Jmol
Position
7q36.1
AA seq 184 aa AA seqDB search
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSS
CSVM
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc
tcattgacgattcaatttgttgaaggccaatttgtggactcctacgatccaaccatagaa
aacacttttacaaagttgatcacagtaaatggacaagaatatcatcttcaacttgtagac
acagccgggcaagatgaatattctatctttcctcagacatactccatagatattaatggc
tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttatccat
ggcaaattgttggatatggtggggaaagtacaaatacctattatgttggttgggaataag
aaagacctgcatatggaaagggtgatcagttatgaagaagggaaagctttggcagaatct
tggaatgcagcttttttggaatcttctgctaaagaaaatcagactgctgtggatgttttt
cgaaggataattttggaggcagaaaaaatggacggggcagcttcacaaggcaagtcttca
tgctcggtgatgtga

DBGET integrated database retrieval system