KEGG   Homo sapiens (human): 6011Help
Entry
6011              CDS       T01001                                 

Gene name
GRK1, GPRK1, RHOK, RK
Definition
(RefSeq) G protein-coupled receptor kinase 1 (EC:2.7.11.14)
  KO
K00909  
rhodopsin kinase [EC:2.7.11.14]
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
Endocytosis
Phototransduction
Disease
H00787  
Congenital stationary night blindness (CSNB)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    6011 (GRK1)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    6011 (GRK1)
  Sensory system
   04744 Phototransduction
    6011 (GRK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.14  rhodopsin kinase
     6011 (GRK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  GRK family [OT]
   6011 (GRK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q34
AA seq 563 aa AA seqDB search
MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFES
VCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAK
LFCSFLDEGIVAKFKEGPVEIQDGLFQPLLQATLAHLGQAPFQEYLGSLYFLRFLQWKWL
EAQPMGEDWFLDFRVLGKGGFGEVSACQMKATGKLYACKKLNKKRLKKRKGYQGAMVEKK
ILMKVHSRFIVSLAYAFETKADLCLVMTIMNGGDIRYHIYNVNEENPGFPEPRALFYTAQ
IICGLEHLHQRRIVYRDLKPENVLLDNDGNVRISDLGLAVELLDGQSKTKGYAGTPGFMA
PELLQGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKHRIISEPVKYPDKFS
QASKDFCEALLEKDPEKRLGFRDETCDKLRAHPLFKDLNWRQLEAGMLMPPFIPDSKTVY
AKDIQDVGAFSTVKGVAFDKTDTEFFQEFATGNCPIPWQEEMIETGIFGELNVWRSDGQM
PDDMKGISGGSSSSSKSGMCLVS
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgggtctttggagaccgtggtggccaactctgccttcatcgccgcccgaggc
agctttgacggcagcagctcccaaccctcccgggacaagaagtacctggccaagctcaag
ctgcccccgctgtccaagtgtgagtccctccgcgacagcctcagcctggagtttgagagt
gtgtgcttggagcagcccatcggcaagaagctctttcagcagttcctacaatcggcagag
aagcacctgccggccctggagctctggaaagacatcgaggactatgacacggcagacaat
gacctccagccacagaaggcccagaccatcctggcccagtacctggacccccaggccaaa
ctcttctgcagcttcctggatgaggggatagtggcgaagtttaaggaggggcctgtggag
atccaggacgggctcttccagcccctgctgcaggccaccctggcacacctgggccaagcc
cccttccaggagtacctgggcagcctgtacttcctgaggttcctgcagtggaagtggctg
gaagcccagcccatgggggaggactggttcctggacttcagggtcctggggaaagggggc
ttcggggaggtgtcggcctgccagatgaaggcgaccggcaagctgtatgcctgcaagaag
ctgaacaagaagcggctgaagaagaggaagggctaccagggtgctatggtggagaagaag
attctgatgaaagtacacagcaggttcatcgtgtctctggcctatgcgtttgaaaccaaa
gccgacctctgtctggtgatgaccatcatgaacggaggtgacatcaggtaccacatctac
aacgtgaatgaggagaaccctggcttcccggagccgcgcgccctcttctacacggcgcag
atcatctgcggcctggagcacctgcaccagaggcggatcgtctaccgcgacctcaagccc
gagaacgtgctgctggacaatgacggcaatgtccggatctctgaccttgggctggccgtg
gagctgctggacggacagagcaagaccaagggctacgcagggaccccaggtttcatggcc
cccgagctcctgcagggcgaggagtacgacttctccgtggactactttgccctgggggtc
accctgtatgagatgattgcggccagaggacccttccgagcccgtggagagaaggtggag
aacaaggagctgaagcaccggatcatctcagagcccgtgaagtaccctgataagttcagc
caggccagcaaggacttctgcgaggcgctgctggagaaggacccggagaagcgcctgggg
ttcagagatgagacctgcgacaagctccgtgcccaccccctcttcaaggaccttaactgg
aggcagctggaggctgggatgctgatgccccctttcatcccagactccaaaactgtctac
gcaaaggatattcaggacgtgggtgccttttccaccgtcaaaggtgtggcctttgacaaa
acagacacagaattctttcaggaatttgccactggcaactgccccatcccctggcaggag
gagatgatcgagacgggcatctttggcgagctgaacgtgtggcgctcggacggtcagatg
ccggacgacatgaagggcatctccgggggctccagctcctcgtccaagtcagggatgtgt
ctggtttcctag

DBGET integrated database retrieval system