KEGG   Homo sapiens (human): 6016Help
Entry
6016              CDS       T01001                                 

Gene name
RIT1, NS8, RIBB, RIT, ROC1
Definition
(RefSeq) Ras-like without CAAX 1
  KO
K07832  
Ras-like without CAAX 1
Organism
hsa  Homo sapiens (human)
Disease
H00523  
Noonan syndrome and related disorders
Brite
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Ras Family
   Rit
    6016 (RIT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q22
AA seq 219 aa AA seqDB search
MDSGTRPVGSCCSSPAGLSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKI
RIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYR
VRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVR
EIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggattctggaactcgcccagttggtagctgctgtagcagccccgctgggctctcacgg
gagtacaaactagtgatgctgggtgctggtggtgtagggaagagtgccatgaccatgcag
ttcatcagccaccgattcccagaagatcatgatcccaccattgaagatgcttataagatc
aggatccgtattgatgatgagcctgccaatctggacattttggatacagctggacaggca
gagtttacagccatgcgggaccagtatatgagggcaggagaagggtttatcatctgttac
tctatcacggatcgtcgaagtttccatgaagttcgtgagtttaaacagcttatttatcga
gtccgacgtactgacgatacacctgtggttcttgtgggaaacaagtcagacctcaaacag
ctaagacaggtcaccaaggaagaaggattggccttggcccgagaattcagctgtcccttt
tttgagacatctgctgcataccgctactatattgatgatgttttccatgcccttgtacgg
gagatacgtaggaaagaaaaggaggcagtactggccatggagaaaaaatctaagcccaaa
aacagtgtatggaagaggctaaaatcaccattccggaagaagaaagattcagtaacttga

DBGET integrated database retrieval system