KEGG   Homo sapiens (human): 602Help
Entry
602               CDS       T01001                                 

Gene name
BCL3, BCL4, D19S37
Definition
(RefSeq) B-cell CLL/lymphoma 3
  KO
K09258  
B-cell CLL/lymphoma protein 3
Organism
hsa  Homo sapiens (human)
Pathway
TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    602 (BCL3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    602 (BCL3)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  Others
   602 (BCL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.32
AA seq 454 aa AA seqDB search
MPRCPAGAMDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGAAGLVVPLDPL
RGGCDLPAVPGPPHGLARPEALYYPGALLPLYPTRAMGSPFPLVNLPTPLYPMMCPMEHP
LSADIAMATRADEDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAV
ITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNY
DGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGA
NVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRG
KATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPSSSPSQSPPRDPPGFPMAPPN
FFLPSPSPPAFLPFAGVLRGPGRPVPPSPAPGGS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgccccgatgccccgcgggggccatggacgaggggcccgtggacctgcgcacccggccc
aaggccgccggactcccgggcgccgcgctgccgctccgcaagcgcccgctgcgcgcgccc
tccccggagcccgccgctccccgcggcgctgcgggccttgtcgtccccctggaccctctg
cgcggcggctgcgacctgccggcggtccccgggcccccccacggcctggcccggccggag
gcgctttactaccccggagccttactgcctttgtaccccactcgggccatgggctccccg
tttcctctggtgaacctgcctacacccctataccccatgatgtgccccatggaacacccc
ctttctgctgacatcgccatggccacccgtgcagatgaggacggagacacgcctctccat
attgctgtggtgcagggtaacctgccagctgtgcaccggctggtcaacctcttccagcag
gggggccgggagctcgacatctacaacaacctacggcagacaccgctccacctggctgtg
atcaccacattaccgtctgtggtccggctcctggtgacagctggtgccagccccatggcg
ctggaccgccatggccagacggccgctcacctggcgtgcgagcaccgcagcccgacctgc
ctgcgagccctgctggacagcgcagctccgggcacgttggacctggaggcccgcaattat
gacgggctcaccgccctgcacgtggcagtgaacaccgagtgccaagaaaccgtgcagctc
ttgctagagcgcggtgccgacatcgacgcagtggacattaagagcggccgctccccgctc
atccacgccgtggaaaacaacagccttagcatggtgcagctgctgctgcagcacggcgcc
aacgtgaacgcgcaaatgtactccggcagctccgccctgcactcagcgtccggccgcggg
ctcctcccgctggtgcgcacgctggtccgcagcggcgctgacagcagcctcaagaactgc
cacaacgacacgccgctcatggtggcgcgcagccgcagggtcatcgacatcctgaggggg
aaggccacccggcctgcttccacctcccagccagacccctcccctgaccggagcgccaac
acctcccccgagagcagcagccgcctcagctccaatggtcttctctccgcatcaccatcc
tcctcaccctcccagtctccccccagggacccccctggattccccatggctcctcccaat
ttcttccttccttccccatctccacccgccttcctgccctttgctggggtcctccgaggc
cctggccggccggtgcccccctccccagctccaggaggcagctga

DBGET integrated database retrieval system