KEGG   Homo sapiens (human): 6036Help
Entry
6036              CDS       T01001                                 

Gene name
RNASE2, EDN, RAF3, RNS2
Definition
ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin) (EC:3.1.27.5)
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     6036 (RNASE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q11.2
AA seq 161 aa AA seqDB search
MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNY
QRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNI
SNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggttccaaaactgttcacttcccaaatttgtctgcttcttctgttggggcttctggct
gtggagggctcactccatgtcaaacctccacagtttacctgggctcaatggtttgaaacc
cagcacatcaatatgacctcccagcaatgcaccaatgcaatgcaggtcattaacaattat
caacggcgatgcaaaaaccaaaatactttccttcttacaacttttgctaacgtagttaat
gtttgtggtaacccaaatatgacctgtcctagtaacaaaactcgcaaaaattgtcaccac
agtggaagccaggtgcctttaatccactgtaacctcacaactccaagtccacagaatatt
tcaaactgcaggtatgcgcagacaccagcaaacatgttctatatagttgcatgtgacaac
agagatcaacgacgagaccctccacagtatccggtggttccagttcacctggatagaatc
atctaa

DBGET integrated database retrieval system