KEGG   Homo sapiens (human): 6037Help
Entry
6037              CDS       T01001                                 

Gene name
RNASE3, ECP, RNS3
Definition
ribonuclease, RNase A family, 3 (EC:3.1.27.-)
Orthology
K10787  
eosinophil cationic protein [EC:3.1.27.-]
Organism
hsa  Homo sapiens (human)
Pathway
Asthma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Immune diseases
   05310 Asthma
    6037 (RNASE3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.-  
     6037 (RNASE3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q11.2
AA seq 160 aa AA seqDB search
MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNY
RWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNI
SNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggttccaaaactgttcacttcccaaatttgtctgcttcttctgttggggcttatgggt
gtggagggctcactccatgccagacccccacagtttacgagggctcagtggtttgccatc
cagcacatcagtctgaacccccctcgatgcaccattgcaatgcgggcaattaacaattat
cgatggcgttgcaaaaaccaaaatacttttcttcgtacaacttttgctaatgtagttaat
gtttgtggtaaccaaagtatacgctgccctcataacagaactctcaacaattgtcatcgg
agtagattccgggtgcctttactccactgtgacctcataaatccaggtgcacagaatatt
tcaaactgcacgtatgcagacagaccaggaaggaggttctatgtagttgcatgtgacaac
agagatccacgggattctccacggtatcctgtggttccagttcacctggataccaccatc
taa

DBGET integrated database retrieval system