KEGG   Homo sapiens (human): 60401Help
Entry
60401             CDS       T01001                                 

Gene name
EDA2R, EDA-A2R, EDAA2R, TNFRSF27, XEDAR
Definition
ectodysplasin A2 receptor
Orthology
K05163  
tumor necrosis factor receptor superfamily member 27
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq12
AA seq 297 aa AA seqDB search
MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQS
CITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAF
QLSLVEADAPTVPPQEATLVALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGLLQFEA
DKTAKEESLFPVPPSKETSAESQVSENIFQTQPLNPILEDDCSSTSGFPTQESFTMASCT
SESHSHWVHSPIECTELDLQKFSSSASYTGAETLGGNTVESTGDRLELNVPFEVPSP
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggattgccaagaaaatgagtactgggaccaatggggacggtgtgtcacctgccaacgg
tgtggtcctggacaggagctatccaaggattgtggttatggagagggtggagatgcctac
tgcacagcctgccctcctcgcaggtacaaaagcagctggggccaccacagatgtcagagt
tgcatcacctgtgctgtcatcaatcgtgttcagaaggtcaactgcacagctacctctaat
gctgtctgtggggactgtttgcccaggttctaccgaaagacacgcattggaggcctgcag
gaccaagagtgcatcccgtgcacgaagcagacccccacctctgaggttcaatgtgccttc
cagttgagcttagtggaggcagatgcacccacagtgccccctcaggaggccacacttgtt
gcactggtgagcagcctgctagtggtgtttaccctggccttcctggggctcttcttcctc
tactgcaagcagttcttcaacagacattgccagcgtggaggtttgctgcagtttgaggct
gataaaacagcaaaggaggaatctctcttccccgtgccacccagcaaggagaccagtgct
gagtcccaagtgagtgagaacatctttcagacccagccacttaaccctatcctcgaggac
gactgcagctcgactagtggcttccccacacaggagtcctttaccatggcctcctgcacc
tcagagagccactcccactgggtccacagccccatcgaatgcacagagctggacctgcaa
aagttttccagctctgcctcctatactggagctgagaccttggggggaaacacagtcgaa
agcactggagacaggctggagctcaatgtgccctttgaagttcccagcccttaa

DBGET integrated database retrieval system