KEGG   Homo sapiens (human): 6041Help
Entry
6041              CDS       T01001                                 

Gene name
RNASEL, PRCA1, RNS4
Definition
ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) (EC:3.1.26.- 3.1.27.-)
Orthology
K01165  
ribonuclease L
Organism
hsa  Homo sapiens (human)
Pathway
Hepatitis C
Influenza A
Herpes simplex infection
Class
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q25
AA seq 741 aa AA seqDB search
MESRDHNNPQEGPTSSSGRRAAVEDNHLLIKAVQNEDVDLVQQLLEGGANVNFQEEEGGW
TPLHNAVQMSREDIVELLLRHGADPVLRKKNGATPFILAAIAGSVKLLKLFLSKGADVNE
CDFYGFTAFMEAAVYGKVKALKFLYKRGANVNLRRKTKEDQERLRKGGATALMDAAEKGH
VEVLKILLDEMGADVNACDNMGRNALIHALLSSDDSDVEAITHLLLDHGADVNVRGERGK
TPLILAVEKKHLGLVQRLLEQEHIEINDTDSDGKTALLLAVELKLKKIAELLCKRGASTD
CGDLVMTARRNYDHSLVKVLLSHGAKEDFHPPAEDWKPQSSHWGAALKDLHRIYRPMIGK
LKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTF
YGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSCG
YTHQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFE
DLKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVG
NESDIKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVG
DLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTH
SPNKPQCDGAGGASGLASPGC
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggagagcagggatcataacaacccccaggagggacccacgtcctccagcggtagaagg
gctgcagtggaagacaatcacttgctgattaaagctgttcaaaacgaagatgttgacctg
gtccagcaattgctggaaggtggagccaatgttaatttccaggaagaggaagggggctgg
acacctctgcataacgcagtacaaatgagcagggaggacattgtggaacttctgcttcgt
catggtgctgaccctgttctgaggaagaagaatggggccacgccttttatcctcgcagcg
attgcggggagcgtgaagctgctgaaacttttcctttctaaaggagcagatgtcaatgag
tgtgatttttatggcttcacagccttcatggaagccgctgtgtatggtaaggtcaaagcc
ctaaaattcctttataagagaggagcaaatgtgaatttgaggcgaaagacaaaggaggat
caagagcggctgaggaaaggaggggccacagctctcatggacgctgctgaaaaaggacac
gtagaggtcttgaagattctccttgatgagatgggggcagatgtaaacgcctgtgacaat
atgggcagaaatgccttgatccatgctctcctgagctctgacgatagtgatgtggaggct
attacgcatctgctgctggaccatggggctgatgtcaatgtgaggggagaaagagggaag
actcccctgatcctggcagtggagaagaagcacttgggtttggtgcagaggcttctggag
caagagcacatagagattaatgacacagacagtgatggcaaaacagcactgctgcttgct
gttgaactcaaactgaagaaaatcgccgagttgctgtgcaaacgtggagccagtacagat
tgtggggatcttgttatgacagcgaggcggaattatgaccattcccttgtgaaggttctt
ctctctcatggagccaaagaagattttcaccctcctgctgaagactggaagcctcagagc
tcacactggggggcagccctgaaggatctccacagaatataccgccctatgattggcaaa
ctcaagttctttattgatgaaaaatacaaaattgctgatacttcagaaggaggcatctac
ctggggttctatgagaagcaagaagtagctgtgaagacgttctgtgagggcagcccacgt
gcacagcgggaagtctcttgtctgcaaagcagccgagagaacagtcacttggtgacattc
tatgggagtgagagccacaggggccacttgtttgtgtgtgtcaccctctgtgagcagact
ctggaagcgtgtttggatgtgcacagaggggaagatgtggaaaatgaggaagatgaattt
gcccgaaatgtcctgtcatctatatttaaggctgttcaagaactacacttgtcctgtgga
tacacccaccaggatctgcaaccacaaaacatcttaatagattctaagaaagctgctcac
ctggcagattttgataagagcatcaagtgggctggagatccacaggaagtcaagagagat
ctagaggaccttggacggctggtcctctatgtggtaaagaagggaagcatctcatttgag
gatctgaaagctcaaagtaatgaagaggtggttcaactttctccagatgaggaaactaag
gacctcattcatcgtctcttccatcctggggaacatgtgagggactgtctgagtgacctg
ctgggtcatcccttcttttggacttgggagagccgctataggacgcttcggaatgtggga
aatgaatccgacatcaaaacacgaaaatctgaaagtgagatcctcagactactgcaacct
gggccttctgaacattccaaaagttttgacaagtggacgactaagattaatgaatgtgtt
atgaaaaaaatgaataagttttatgaaaaaagaggcaatttctaccagaacactgtgggt
gatctgctaaagttcatccggaatttgggagaacacattgatgaagaaaagcataaaaag
atgaaattaaaaattggagacccttccctgtattttcagaagacatttccagatctggtg
atctatgtctacacaaaactacagaacacagaatatagaaagcatttcccccaaacccac
agtccaaacaagcctcagtgtgatggagctggtggggccagtgggttggccagccctggg
tgctga

DBGET integrated database retrieval system