KEGG   Homo sapiens (human): 60436Help
Entry
60436             CDS       T01001                                 

Gene name
TGIF2
Definition
(RefSeq) TGFB induced factor homeobox 2
  KO
K19553  homeobox protein TGIF2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    60436 (TGIF2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, TGIF
    60436 (TGIF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeobox_KN Homeobox
Motif
Other DBs
NCBI-GeneID: 60436
NCBI-ProteinID: NP_001186442
OMIM: 607294
HGNC: 15764
Ensembl: ENSG00000118707
Vega: OTTHUMG00000172332
Pharos: Q9GZN2(Tbio)
UniProt: Q9GZN2
Position
20q11.23
AA seq 237 aa AA seqDB search
MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNL
SVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPA
PTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLF
NTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacagtgatctaggtgaggacgaaggcctcctctccctggcgggcaaaaggaag
cgcagggggaacctgcccaaggagtcggtgaagatcctccgggactggctgtacttgcac
cgctacaacgcctacccctcagagcaggagaagctgagcctttctggacagaccaacctg
tcagtgctgcaaatatgtaactggttcatcaatgcccggcggcggcttctcccagacatg
cttcggaaggatggcaaagaccctaatcagtttaccatttcccgccgcgggggtaaggcc
tcagatgtggccctcccccgtggcagcagcccctcagtgctggctgtgtctgtcccagcc
cccaccaatgtgctctccctgtctgtgtgctccatgccgcttcactcaggccagggggaa
aagccagcagcccctttcccacgtggggagctggagtctcccaagcccctggtgacccct
ggtagcacacttactctgctgaccagggctgaggctggaagccccacaggtggactcttc
aacacgccaccacccacacccccagagcaggacaaagaggacttcagcagcttccagctg
ctggtggaggtggcgctacagagggctgctgagatggagcttcagaagcagcaggaccca
tcactcccattactgcacactcccatccctttagtctctgaaaatccccagtag

DBGET integrated database retrieval system