KEGG   Homo sapiens (human): 6048Help
Entry
6048              CDS       T01001                                 

Gene name
RNF5, RING5, RMA1
Definition
(RefSeq) ring finger protein 5
  KO
K10666  
E3 ubiquitin-protein ligase RNF5 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6048 (RNF5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     6048 (RNF5)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    6048 (RNF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q99942(Tbio)
UniProt: 
Position
6p21.32
AA seq 180 aa AA seqDB search
MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPE
RQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGF
HFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagcggaggaggaggacgggggccccgaagggccaaatcgcgagcggggcggg
gcgggcgcgaccttcgaatgtaatatatgtttggagactgctcgggaagctgtggtcagt
gtgtgtggccacctgtactgttggccatgtcttcatcagtggctggagacacggccagaa
cggcaagagtgtccagtatgtaaagctgggatcagcagagagaaggttgtcccgctttat
gggcgagggagccagaagccccaggatcccagattaaaaactccaccccgcccccagggc
cagagaccagctccggagagcagagggggattccagccatttggtgataccgggggcttc
cacttctcatttggtgttggtgcttttccctttggctttttcaccaccgtcttcaatgcc
catgagcctttccgccggggtacaggtgtggatctgggacagggtcacccagcctccagc
tggcaggattccctcttcctgtttctcgccatcttcttctttttttggctgctcagtatt
tga

DBGET integrated database retrieval system