KEGG   Homo sapiens (human): 60495Help
Entry
60495             CDS       T01001                                 

Gene name
HPSE2, HPA2, HPR2, UFS, UFS1
Definition
(RefSeq) heparanase 2 (inactive)
  KO
K07965  
heparanase 2 [EC:3.2.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan degradation
Metabolic pathways
Proteoglycans in cancer
Module
Heparan sulfate degradation
Disease
H00753  
Urofacial syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    60495 (HPSE2)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    60495 (HPSE2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.-  
     60495 (HPSE2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   60495 (HPSE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
10q24.2
AA seq 592 aa AA seqDB search
MRVLCAFPEAMPSSNSRPPACLAPGALYLALLLHLSLSSQAGDRRPLPVDRAAGLKEKTL
ILLDVSTKNPVRTVNENFLSLQLDPSIIHDGWLDFLSSKRLVTLARGLSPAFLRFGGKRT
DFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREK
AAQMHLVLLKEQFSNTYSNLILTARSLDKLYNFADCSGLHLIFALNALRRNPNNSWNSSS
ALSLLKYSASKKYNISWELGNEPNNYRTMHGRAVNGSQLGKDYIQLKSLLQPIRIYSRAS
LYGPNIGRPRKNVIALLDGFMKVAGSTVDAVTWQHCYIDGRVVKVMDFLKTRLLDTLSDQ
IRKIQKVVNTYTPGKKIWLEGVVTTSAGGTNNLSDSYAAGFLWLNTLGMLANQGIDVVIR
HSFFDHGYNHLVDQNFNPLPDYWLSLLYKRLIGPKVLAVHVAGLQRKPRPGRVIRDKLRI
YAHCTNHHNHNYVRGSITLFIINLHRSRKKIKLAGTLRDKLVHQYLLQPYGQEGLKSKSV
QLNGQPLVMVDDGTLPELKPRPLRAGRTLVIPPVTMGFYVVKNVNALACRYR
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgagggtgctttgtgccttccctgaagccatgccctccagcaactcccgcccccccgcg
tgcctagccccgggggctctctacttggctctgttgctccatctctccctttcctcccag
gctggagacaggagacccttgcctgtagacagagctgcaggtttgaaggaaaagaccctg
attctacttgatgtgagcaccaagaacccagtcaggacagtcaatgagaacttcctctct
ctgcagctggatccgtccatcattcatgatggctggctcgatttcctaagctccaagcgc
ttggtgaccctggcccggggactttcgcccgcctttctgcgcttcgggggcaaaaggacc
gacttcctgcagttccagaacctgaggaacccggcgaaaagccgcgggggcccgggcccg
gattactatctcaaaaactatgaggatgacattgttcgaagtgatgttgccttagataaa
cagaaaggctgcaagattgcccagcaccctgatgttatgctggagctccaaagggagaag
gcagctcagatgcatctggttcttctaaaggagcaattctccaatacttacagtaatctc
atattaacagccaggtctctagacaaactttataactttgctgattgctctggactccac
ctgatatttgctctaaatgcactgcgtcgtaatcccaataactcctggaacagttctagt
gccctgagtctgttgaagtacagcgccagcaaaaagtacaacatttcttgggaactgggt
aatgagccaaataactatcggaccatgcatggccgggcagtaaatggcagccagttggga
aaggattacatccagctgaagagcctgttgcagcccatccggatttattccagagccagc
ttatatggccctaatattgggcggccgaggaagaatgtcatcgccctcctagatggattc
atgaaggtggcaggaagtacagtagatgcagttacctggcaacattgctacattgatggc
cgggtggtcaaggtgatggacttcctgaaaactcgcctgttagacacactctctgaccag
attaggaaaattcagaaagtggttaatacatacactccaggaaagaagatttggcttgaa
ggtgtggtgaccacctcagctggaggcacaaacaatctatccgattcctatgctgcagga
ttcttatggttgaacactttaggaatgctggccaatcagggcattgatgtcgtgatacgg
cactcattttttgaccatggatacaatcacctcgtggaccagaattttaacccattacca
gactactggctctctctcctctacaagcgcctgatcggccccaaagtcttggctgtgcat
gtggctgggctccagcggaagccacggcctggccgagtgatccgggacaaactaaggatt
tatgctcactgcacaaaccaccacaaccacaactacgttcgtgggtccattacacttttt
atcatcaacttgcatcgatcaagaaagaaaatcaagctggctgggactctcagagacaag
ctggttcaccagtacctgctgcagccctatgggcaggagggcctaaagtccaagtcagtg
caactgaatggccagcccttagtgatggtggacgacgggaccctcccagaattgaagccc
cgcccccttcgggccggccggacattggtcatccctccagtcaccatgggcttttatgtg
gtcaagaatgtcaatgctttggcctgccgctaccgataa

DBGET integrated database retrieval system