KEGG   Homo sapiens (human): 60495Help
Entry
60495             CDS       T01001                                 

Gene name
HPSE2, HPA2, HPR2, UFS, UFS1
Definition
heparanase 2
Orthology
K07965  
heparanase 2 [EC:3.2.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan degradation
Metabolic pathways
Proteoglycans in cancer
Module
Heparan sulfate degradation
Disease
H00753  
Urofacial syndrome
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:hsa00531]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
10q23-q24
AA seq 534 aa AA seqDB search
MRVLCAFPEAMPSSNSRPPACLAPGALYLALLLHLSLSSQAGDRRPLPVDRAAGLKEKTL
ILLDVSTKNPVRTVNENFLSLQLDPSIIHDGWLDFLSSKRLVTLARGLSPAFLRFGGKRT
DFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREK
AAQMHLVLLKEQFSNTYSNLILTEPNNYRTMHGRAVNGSQLGKDYIQLKSLLQPIRIYSR
ASLYGPNIGRPRKNVIALLDGFMKVAGSTVDAVTWQHCYIDGRVVKVMDFLKTRLLDTLS
DQIRKIQKVVNTYTPGKKIWLEGVVTTSAGGTNNLSDSYAAGFLWLNTLGMLANQGIDVV
IRHSFFDHGYNHLVDQNFNPLPDYWLSLLYKRLIGPKVLAVHVAGLQRKPRPGRVIRDKL
RIYAHCTNHHNHNYVRGSITLFIINLHRSRKKIKLAGTLRDKLVHQYLLQPYGQEGLKSK
SVQLNGQPLVMVDDGTLPELKPRPLRAGRTLVIPPVTMGFYVVKNVNALACRYR
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgagggtgctttgtgccttccctgaagccatgccctccagcaactcccgcccccccgcg
tgcctagccccgggggctctctacttggctctgttgctccatctctccctttcctcccag
gctggagacaggagacccttgcctgtagacagagctgcaggtttgaaggaaaagaccctg
attctacttgatgtgagcaccaagaacccagtcaggacagtcaatgagaacttcctctct
ctgcagctggatccgtccatcattcatgatggctggctcgatttcctaagctccaagcgc
ttggtgaccctggcccggggactttcgcccgcctttctgcgcttcgggggcaaaaggacc
gacttcctgcagttccagaacctgaggaacccggcgaaaagccgcgggggcccgggcccg
gattactatctcaaaaactatgaggatgacattgttcgaagtgatgttgccttagataaa
cagaaaggctgcaagattgcccagcaccctgatgttatgctggagctccaaagggagaag
gcagctcagatgcatctggttcttctaaaggagcaattctccaatacttacagtaatctc
atattaacagagccaaataactatcggaccatgcatggccgggcagtaaatggcagccag
ttgggaaaggattacatccagctgaagagcctgttgcagcccatccggatttattccaga
gccagcttatatggccctaatattgggcggccgaggaagaatgtcatcgccctcctagat
ggattcatgaaggtggcaggaagtacagtagatgcagttacctggcaacattgctacatt
gatggccgggtggtcaaggtgatggacttcctgaaaactcgcctgttagacacactctct
gaccagattaggaaaattcagaaagtggttaatacatacactccaggaaagaagatttgg
cttgaaggtgtggtgaccacctcagctggaggcacaaacaatctatccgattcctatgct
gcaggattcttatggttgaacactttaggaatgctggccaatcagggcattgatgtcgtg
atacggcactcattttttgaccatggatacaatcacctcgtggaccagaattttaaccca
ttaccagactactggctctctctcctctacaagcgcctgatcggccccaaagtcttggct
gtgcatgtggctgggctccagcggaagccacggcctggccgagtgatccgggacaaacta
aggatttatgctcactgcacaaaccaccacaaccacaactacgttcgtgggtccattaca
ctttttatcatcaacttgcatcgatcaagaaagaaaatcaagctggctgggactctcaga
gacaagctggttcaccagtacctgctgcagccctatgggcaggagggcctaaagtccaag
tcagtgcaactgaatggccagcccttagtgatggtggacgacgggaccctcccagaattg
aagccccgcccccttcgggccggccggacattggtcatccctccagtcaccatgggcttt
tatgtggtcaagaatgtcaatgctttggcctgccgctaccgataa

DBGET integrated database retrieval system