KEGG   Homo sapiens (human): 60559Help
Entry
60559             CDS       T01001                                 

Gene name
SPCS3, PRO3567, SPC22/23, SPC3, YLR066W
Definition
signal peptidase complex subunit 3 homolog (S. cerevisiae)
Orthology
K12948  
signal peptidase complex subunit 3 [EC:3.4.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Protein export
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:hsa03060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q34.2
AA seq 180 aa AA seqDB search
MNTVLSRANSLFAFSLSVMAALTFGCFITTAFKDRSVPVRLHVSRIMLKNVEDFTGPRER
SDLGFITFDITADLENIFDWNVKQLFLYLSAEYSTKNNALNQVVLWDKIVLRGDNPKLLL
KDMKTKYFFFDDGNGLKGNRNVTLTLSWNVVPNAGILPLVTGSGHVSVPFPDTYEITKSY
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggtgctgtcgcgggcgaactcactgttcgccttctcgctgagcgtgatggcg
gcgctcaccttcggctgcttcatcaccaccgccttcaaagacaggagcgtcccggtgcgg
ctgcacgtctcgcggatcatgctaaaaaatgtagaagatttcactggacctagagaaaga
agtgatctgggatttatcacatttgatataactgctgatctagagaatatatttgattgg
aatgttaagcagttgtttctttatttatcagcagaatattcaacaaaaaataatgctctg
aaccaagttgtcctatgggacaagattgttttgagaggtgataatccgaagctgctgctg
aaagatatgaaaacaaaatattttttctttgacgatggaaatggtctcaagggaaacagg
aatgtcactttgaccctgtcttggaacgtcgtaccaaatgctggaattctacctcttgtg
acaggatcaggacacgtatctgtcccatttccagatacatatgaaataacgaagagttat
taa

DBGET integrated database retrieval system