KEGG   Homo sapiens (human): 607Help
Entry
607               CDS       T01001                                 

Gene name
BCL9, LGS
Definition
(RefSeq) B-cell CLL/lymphoma 9
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21
AA seq 1426 aa AA seqDB search
MHSSNPKVRSSPSGNTQSSPKSKQEVMVRPPTVMSPSGNPQLDSKFSNQGKQGGSASQSQ
PSPCDSKSGGHTPKALPGPGGSMGLKNGAGNGAKGKGKRERSISADSFDQRDPGTPNDDS
DIKECNSADHIKSQDSQHTPHSMTPSNATAPRSSTPSHGQTTATEPTPAQKTPAKVVYVF
STEMANKAAEAVLKGQVETIVSFHIQNISNNKTERSTAPLNTQISALRNDPKPLPQQPPA
PANQDQNSSQNTRLQPTPPIPAPAPKPAAPPRPLDRESPGVENKLIPSVGSPASSTPLPP
DGTGPNSTPNNRAVTPVSQGSNSSSADPKAPPPPPVSSGEPPTLGENPDGLSQEQLEHRE
RSLQTLRDIQRMLFPDEKEFTGAQSGGPQQNPGVLDGPQKKPEGPIQAMMAQSQSLGKGP
GPRTDVGAPFGPQGHRDVPFSPDEMVPPSMNSQSGTIGPDHLDHMTPEQIAWLKLQQEFY
EEKRRKQEQVVVQQCSLQDMMVHQHGPRGVVRGPPPPYQMTPSEGWAPGGTEPFSDGINM
PHSLPPRGMAPHPNMPGSQMRLPGFAGMINSEMEGPNVPNPASRPGLSGVSWPDDVPKIP
DGRNFPPGQGIFSGPGRGERFPNPQGLSEEMFQQQLAEKQLGLPPGMAMEGIRPSMEMNR
MIPGSQRHMEPGNNPIFPRIPVEGPLSPSRGDFPKGIPPQMGPGRELEFGMVPSGMKGDV
NLNVNMGSNSQMIPQKMREAGAGPEEMLKLRPGGSDMLPAQQKMVPLPFGEHPQQEYGMG
PRPFLPMSQGPGSNSGLRNLREPIGPDQRTNSRLSHMPPLPLNPSSNPTSLNTAPPVQRG
LGRKPLDISVAGSQVHSPGINPLKSPTMHQVQSPMLGSPSGNLKSPQTPSQLAGMLAGPA
AAASIKSPPVLGSAAASPVHLKSPSLPAPSPGWTSSPKPPLQSPGIPPNHKAPLTMASPA
MLGNVESGGPPPPTASQPASVNIPGSLPSSTPYTMPPEPTLSQNPLSIMMSRMSKFAMPS
STPLYHDAIKTVASSDDDSPPARSPNLPSMNNMPGMGINTQNPRISGPNPVVPMPTLSPM
GMTQPLSHSNQMPSPNAVGPNIPPHGVPMGPGLMSHNPIMGHGSQEPPMVPQGRMGFPQG
FPPVQSPPQQVPFPHNGPSGGQGSFPGGMGFPGEGPLGRPSNLPQSSADAALCKPGGPGG
PDSFTVLGNSMPSVFTDPDLQEVIRPGATGIPEFDLSRIIPSEKPSQTLQYFPRGEVPGR
KQPQGPGPGFSHMQGMMGEQAPRMGLALPGMGGPGPVGTPDIPLGTAPSMPGHNPMRPPA
FLQQGMMGPHHRMMSPAQSTMPGQPTLMSNPAAAVGMIPGKDRGPAGLYTHPGPVGSPGM
MMSMQGMMGPQQNIMIPPQMRPRGMAADVGMGGFSQGPGNPGNMMF
NT seq 4281 nt NT seq  +upstreamnt  +downstreamnt
atgcattccagtaaccctaaagtgaggagctctccatcaggaaacacacagagtagccct
aagtcaaagcaggaggtgatggtccgtccccctacagtgatgtccccatctggaaacccc
cagctggattccaaattctccaatcagggtaaacaggggggctcagccagccaatcccag
ccatccccctgtgactccaagagtgggggccatacccctaaagcactccctggcccaggt
gggagcatggggctgaagaatggggctggaaatggtgccaagggcaaggggaaaagggag
cgaagtatttccgccgactcctttgatcagagagatcctgggactccaaacgatgactct
gacattaaagaatgtaattctgctgaccacataaagtcccaggattcccagcacacacca
cactcgatgaccccatcaaatgctacagcccccaggtcttctaccccctcccatggccaa
actactgccacagagcccacacctgctcagaagactccagccaaagtggtgtacgtgttt
tctactgagatggccaataaagctgcagaagctgttttgaagggccaggttgaaactatc
gtctctttccacatccagaacatttctaacaacaagacagagagaagcacagcgcctctg
aacacacagatatctgcccttcggaatgatccgaaacctctcccacaacagcccccagct
ccggccaaccaggaccagaattcttcccagaataccagactgcagccaactccacccatt
ccggcaccagcacccaagcctgccgcacccccacgtcccctggaccgggagagtcctggg
gtagaaaacaaactgattccttctgtaggaagtcctgccagctccactccactgccccca
gatggtactgggcccaactcaactcccaacaatagggcagtgacccctgtctcccagggg
agcaatagctcttcagcagatcccaaagcccctccgcctccaccagtgtccagtggcgag
ccccccacactgggagagaatcccgatggcctatctcaggagcagctggagcaccgggag
cgctccttacaaactctcagagatatccagcgcatgctttttcctgatgagaaagaattc
acaggagcacaaagtgggggaccgcagcagaatcctggggtattagatgggcctcagaaa
aaaccagaagggccaatacaggccatgatggcccaatcccaaagcctaggtaagggacct
gggccccggacagacgtgggagctccatttggccctcaaggacatagagatgtacccttt
tctccagatgaaatggttccaccttctatgaactcccagtctgggaccataggacccgac
caccttgaccatatgactcccgagcagatagcgtggctgaaactgcagcaggagttttat
gaagagaagaggaggaagcaggaacaagtggttgtccagcagtgttccctccaggacatg
atggtccatcagcacgggcctcggggagtggtccgaggacccccccctccataccagatg
acccctagtgaaggctgggcacctgggggtacagagccattttctgatggtatcaacatg
ccacattctctgcccccgaggggcatggctccccaccccaacatgccagggagccagatg
cgcctccctggatttgcaggcatgataaactctgaaatggaagggccgaatgtccccaac
cctgcatctagaccaggtctttctggagtcagttggccagatgatgtgccaaaaatccca
gatggtcgaaattttcctcctggccagggcattttcagcggtcctggccgaggggaacgc
ttcccaaacccccaaggattgtctgaagagatgtttcagcagcagctggcagagaaacag
ctgggtctccccccagggatggccatggaaggcatcaggcccagcatggagatgaacagg
atgattccaggctcccagcgccacatggagcctgggaataaccccattttccctcgaata
ccagttgagggccctctgagtccttctaggggtgactttccaaaaggaattcccccacag
atgggccctggtcgggaacttgagtttgggatggttcctagtgggatgaagggagatgtc
aatctaaatgtcaacatgggatccaactctcagatgatacctcagaagatgagagaggct
ggggcgggccctgaggagatgctgaaattacgcccaggtggctcagacatgctgcctgct
cagcagaagatggtgccactgccatttggtgagcacccccagcaggagtatggcatgggc
cccagaccattccttcccatgtctcagggtccaggcagcaacagtggcttgcggaatctc
agagaaccaattgggcccgaccagaggactaacagccggctcagtcatatgccaccacta
cctctcaacccttccagtaaccccaccagcctcaacacagctcctccagttcagcgcggc
ctggggcggaagcccttggatatatctgtggcaggcagccaggtgcattccccaggcatt
aaccctctgaagtctcccacgatgcaccaagtccagtcaccaatgctgggctcgccctcg
gggaacctcaagtccccccagactccatcgcagctggcaggcatgctggcgggcccagct
gctgctgcttccattaagtccccccctgttttggggtctgctgctgcttcacctgtccac
ctcaagtctccatcacttcctgccccgtcacctggatggacctcttctccaaaacctccc
cttcagagtcctgggatccctccaaaccataaagcacccctcaccatggcctccccagcc
atgctgggaaatgtagagtcaggtggccccccacctcctacagccagccagcctgcctct
gtgaatatccctggaagtcttccctctagtacaccttataccatgcctccagagccaacc
ctttcccagaacccactctctattatgatgtctcgaatgtccaagtttgcaatgcccagt
tccaccccgttataccatgatgctatcaagactgtggccagctcagatgacgactcccct
ccagctcgttctcccaacttgccatcaatgaataatatgccaggaatgggcattaataca
cagaatcctcgaatttcaggtccaaaccccgtggttccgatgccaaccctcagcccaatg
ggaatgacccagccactttctcactccaatcagatgccctctccaaatgccgtgggaccc
aacatacctcctcatggggtcccaatggggcctggcttgatgtcacacaatcctatcatg
gggcatgggtcccaggagccaccgatggtacctcaaggacggatgggcttcccccagggc
ttccctccagtacagtctcccccacagcaggttccattccctcacaatggccccagtggg
gggcagggcagcttcccaggagggatgggtttcccaggagaaggcccccttggccgcccc
agcaacctgccccaaagttcagcagatgcagcactttgcaagcctggaggccccgggggt
cctgactccttcactgtcctggggaacagcatgccttcggtgtttacagacccagatctg
caggaggtcatccgacctggagccaccggaatacctgagtttgatctatcccgcattatt
ccatctgagaagcccagccagacgctgcaatatttccctcgaggggaagttccaggccgt
aaacagccccagggtcctggacctgggttttcacacatgcaggggatgatgggcgaacaa
gcccccagaatgggactagcattacctggcatgggaggtccagggccagtgggaactccg
gacatccctcttggtacagctccatccatgccaggccacaaccccatgagaccaccagcc
tttctccaacaaggcatgatgggacctcaccatcggatgatgtcaccagcacaatctaca
atgcccggccagcccaccctgatgagcaatccagctgctgccgtgggcatgattcctggc
aaggatcgggggcctgccgggctctacacccaccctgggcctgtgggctctccaggcatg
atgatgtccatgcagggcatgatgggaccccaacagaacatcatgatccccccacagatg
aggccccggggcatggctgctgacgtgggcatgggtggatttagccaaggacctggcaac
ccaggaaacatgatgttttaa

DBGET integrated database retrieval system