KEGG   Homo sapiens (human): 608Help
Entry
608               CDS       T01001                                 

Gene name
TNFRSF17, BCM, BCMA, CD269, TNFRSF13A
Definition
tumor necrosis factor receptor superfamily, member 17
Orthology
K05153  
tumor necrosis factor receptor superfamily member 17
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    608 (TNFRSF17)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    608 (TNFRSF17)
Cellular antigens [BR:hsa04090]
 Proteins
  608 (TNFRSF17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.1
AA seq 184 aa AA seqDB search
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCL
GLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLE
YTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKS
ISAR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagatggctgggcagtgctcccaaaatgaatattttgacagtttgttgcatgct
tgcataccttgtcaacttcgatgttcttctaatactcctcctctaacatgtcagcgttat
tgtaatgcaagtgtgaccaattcagtgaaaggaacgaatgcgattctctggacctgtttg
ggactgagcttaataatttctttggcagttttcgtgctaatgtttttgctaaggaagata
aactctgaaccattaaaggacgagtttaaaaacacaggatcaggtctcctgggcatggct
aacattgacctggaaaagagcaggactggtgatgaaattattcttccgagaggcctcgag
tacacggtggaagaatgcacctgtgaagactgcatcaagagcaaaccgaaggtcgactct
gaccattgctttccactcccagctatggaggaaggcgcaaccattcttgtcaccacgaaa
acgaatgactattgcaagagcctgccagctgctttgagtgctacggagatagagaaatca
atttctgctaggtaa

DBGET integrated database retrieval system