KEGG   Homo sapiens (human): 608Help
Entry
608               CDS       T01001                                 

Gene name
TNFRSF17, BCM, BCMA, CD269, TNFRSF13A
Definition
(RefSeq) TNF receptor superfamily member 17
  KO
K05153  tumor necrosis factor receptor superfamily member 17
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    608 (TNFRSF17)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    608 (TNFRSF17)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   608 (TNFRSF17)
CD molecules [BR:hsa04090]
 Proteins
  608 (TNFRSF17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCMA-Tall_bind TACI-CRD2 Adipogenin
Motif
Other DBs
NCBI-GeneID: 608
NCBI-ProteinID: NP_001183
OMIM: 109545
HGNC: 11913
Ensembl: ENSG00000048462
Vega: OTTHUMG00000129826
Pharos: Q02223(Tbio)
UniProt: Q02223
Structure
PDB: 

Jmol
Position
16p13.13
AA seq 184 aa AA seqDB search
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCL
GLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLE
YTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKS
ISAR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagatggctgggcagtgctcccaaaatgaatattttgacagtttgttgcatgct
tgcataccttgtcaacttcgatgttcttctaatactcctcctctaacatgtcagcgttat
tgtaatgcaagtgtgaccaattcagtgaaaggaacgaatgcgattctctggacctgtttg
ggactgagcttaataatttctttggcagttttcgtgctaatgtttttgctaaggaagata
aactctgaaccattaaaggacgagtttaaaaacacaggatcaggtctcctgggcatggct
aacattgacctggaaaagagcaggactggtgatgaaattattcttccgagaggcctcgag
tacacggtggaagaatgcacctgtgaagactgcatcaagagcaaaccgaaggtcgactct
gaccattgctttccactcccagctatggaggaaggcgcaaccattcttgtcaccacgaaa
acgaatgactattgcaagagcctgccagctgctttgagtgctacggagatagagaaatca
atttctgctaggtaa

DBGET integrated database retrieval system