KEGG   Homo sapiens (human): 6091Help
Entry
6091              CDS       T01001                                 

Gene name
ROBO1, DUTT1, SAX3
Definition
roundabout, axon guidance receptor, homolog 1 (Drosophila)
Orthology
K06753  
roundabout, axon guidance receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    6091 (ROBO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p12
AA seq 1551 aa AA seqDB search
MIAEPAHFYLFGLICLCSGSRLRQEDFPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTI
EWYKGGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRKSRPDEGVYVCVARNYLGEAVSH
NASLEVAILRDDFRQNPSDVMVAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERIT
IRGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSA
EFKCEARGDPVPTVRWRKDDGELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKA
EASATLTVQVGSEPPHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSY
QPPQSSSRFSVSQTGDLTITNVQRSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPV
IRQGPVNQTVAVDGTFVLSCVATGSPVPTILWRKDGVLVSTQDSRIKQLENGVLQIRYAK
LGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNT
VTLSWQPNLNSGATPTSYIIEAFSHASGSSWQTVAENVKTETSAIKGLKPNAIYLFLVRA
ANAYGISDPSQISDPVKTQDVLPTSQGVDHKQVQRELGNAVLHLHNPTVLSSSSIEVHWT
VDQQSQYIQGYKILYRPSGANHGESDWLVFEVRTPAKNSVVIPDLRKGVNYEIKARPFFN
EFQGADSEIKFAKTLEEAPSAPPQGVTVSKNDGNGTAILVSWQPPPEDTQNGMVQEYKVW
CLGNETRYHINKTVDGSTFSVVIPFLVPGIRYSVEVAASTGAGSGVKSEPQFIQLDAHGN
PVSPEDQVSLAQQISDVVKQPAFIAGIGAACWIILMVFSIWLYRHRKKRNGLTSTYAGIR
KVTYQRGGEAVSSGGRPGLLNISEPAAQPWLADTWPNTGNNHNDCSISCCTAGNGNSDSN
LTTYSRPGQPTPYATTQLIQSNLSNNMNNGSGDSGEKHWKPLGQQKQEVAPVQYNIVEQN
KLNKDYRANDTVPPTIPYNQSYDQNTGGSYNSSDRGSSTSGSQGHKKGARTPKVPKQGGM
NWADLLPPPPAHPPPHSNSEEYNISVDESYDQEMPCPVPPARMYLQQDELEEEEDERGPT
PPVRGAASSPAAVSYSHQSTATLTPSPQEELQPMLQDCPEETGHMQHQPDRRRQPVSPPP
PPRPISPPHTYGYISGPLVSDMDTDAPEEEEDEADMEVAKMQTRRLLLRGLEQTPASSVG
DLESSVTGSMINGWGSASEEDNISSGRSSVSSSDGSFFTDADFAQAVAAAAEYAGLKVAR
RQMQDAAGRRHFHASQCPRPTSPVSTDSNMSAAVMQKTRPAKKLKHQPGHLRRETYTDDL
PPPPVPPPAIKSPTAQSKTQLEVRPVVVPKLPSMDARTDRSSDRKGSSYKGREVLDGRQV
VDMRTNPGDPREAQEQQNDGKGRGNKAAKRDLPPAKTHLIQEDILPYCRPTFPTSNNPRD
PSSSSSMSSRGSGSRQREQANVGRRNIAEMQVLGGYERGEDNNEELEETES
NT seq 4656 nt NT seq  +upstreamnt  +downstreamnt
atgattgcggagcccgctcacttttacctgtttggattaatatgtctctgttcaggctcc
cgtcttcgtcaggaagattttccacctcgcattgttgaacacccttcagacctgattgtc
tcaaaaggagaacctgcaactttgaactgcaaagctgaaggccgccccacacccactatt
gaatggtacaaagggggagagagagtggagacagacaaagatgaccctcgctcacaccga
atgttgctgccgagtggatctttatttttcttacgtatagtacatggacggaaaagtaga
cctgatgaaggagtctatgtctgtgtagcaaggaattaccttggagaggctgtgagccac
aatgcatcgctggaagtagccatacttcgggatgacttcagacaaaacccttcggatgtc
atggttgcagtaggagagcctgcagtaatggaatgccaacctccacgaggccatcctgag
cccaccatttcatggaagaaagatggctctccactggatgataaagatgaaagaataact
atacgaggaggaaagctcatgatcacttacacccgtaaaagtgacgctggcaaatatgtt
tgtgttggtaccaatatggttggggaacgtgagagtgaagtagccgagctgactgtctta
gagagaccatcatttgtgaagagacccagtaacttggcagtaactgtggatgacagtgca
gaatttaaatgtgaggcccgaggtgaccctgtacctacagtacgatggaggaaagatgat
ggagagctgcccaaatccagatatgaaatccgagatgatcataccttgaaaattaggaag
gtgacagctggtgacatgggttcatacacttgtgttgcagaaaatatggtgggcaaagct
gaagcatctgctactctgactgttcaagttgggtctgaacctccacattttgttgtgaaa
ccccgtgaccaggttgttgctttgggacggactgtaacttttcagtgtgaagcaaccgga
aatcctcaaccagctattttctggaggagagaagggagtcagaatctacttttctcatat
caaccaccacagtcatccagccgattttcagtctcccagactggcgacctcacaattact
aatgtccagcgatctgatgttggttattacatctgccagactttaaatgttgctggaagc
atcatcacaaaggcatatttggaagttacagatgtgattgcagatcggcctcccccagtt
attcgacaaggtcctgtgaatcagactgtagccgtggatggcactttcgtcctcagctgt
gtggccacaggcagtccagtgcccaccattctgtggagaaaggatggagtcctcgtttca
acccaagactctcgaatcaaacagttggagaatggagtactgcagatccgatatgctaag
ctgggtgatactggtcggtacacctgcattgcatcaacccccagtggtgaagcaacatgg
agtgcttacattgaagttcaagaatttggagttccagttcagcctccaagacctactgac
ccaaatttaatccctagtgccccatcaaaacctgaagtgacagatgtcagcagaaataca
gtcacattatcgtggcaaccaaatttgaattcaggagcaactccaacatcttatattata
gaagccttcagccatgcatctggtagcagctggcagaccgtagcagagaatgtgaaaaca
gaaacatctgccattaaaggactcaaacctaatgcaatttaccttttccttgtgagggca
gctaatgcatatggaattagtgatccaagccaaatatcagatccagtgaaaacacaagat
gtcctaccaacaagtcagggggtggaccacaagcaggtccagagagagctgggaaatgct
gttctgcacctccacaaccccaccgtcctttcttcctcttccatcgaagtgcactggaca
gtagatcaacagtctcagtatatacaaggatataaaattctctatcggccatctggagcc
aaccacggagaatcagactggttagtttttgaagtgaggacgccagccaaaaacagtgtg
gtaatccctgatctcagaaagggagtcaactatgaaattaaggctcgccctttttttaat
gaatttcaaggagcagatagtgaaatcaagtttgccaaaaccctggaagaagcacccagt
gccccaccccaaggtgtaactgtatccaagaatgatggaaacggaactgcaattctagtt
agttggcagccacctccagaagacactcaaaatggaatggtccaagagtataaggtttgg
tgtctgggcaatgaaactcgataccacatcaacaaaacagtggatggttccaccttttcc
gtggtcattccctttcttgttcctggaatccgatacagtgtggaagtggcagccagcact
ggggctgggtctggggtaaagagtgagcctcagttcatccagctggatgcccatggaaac
cctgtgtcacctgaggaccaagtcagcctcgctcagcagatttcagatgtggtgaagcag
ccggccttcatagcaggtattggagcagcctgttggatcatcctcatggtcttcagcatc
tggctttatcgacaccgcaagaagagaaacggacttactagtacctacgcgggtatcaga
aaagtaacttaccagagaggaggcgaagctgtcagcagtggagggaggcctggacttctc
aacatcagtgaacctgccgcgcagccatggctggcagacacgtggcctaatactggcaac
aaccacaatgactgctccatcagctgctgcacggcaggcaatggaaacagcgacagcaac
ctcactacctacagtcgcccagggcagcctactccttacgccaccactcagctcatccag
tcaaacctcagcaacaacatgaacaatggcagcggggactctggcgagaagcactggaaa
ccactgggacagcagaaacaagaagtggcaccagttcagtacaacatcgtggagcaaaac
aagctgaacaaagattatcgagcaaatgacacagttcctccaactatcccatacaaccaa
tcatacgaccagaacacaggaggatcctacaacagctcagaccggggcagtagtacatct
gggagtcaggggcacaagaaaggggcaagaacacccaaggtaccaaaacagggtggcatg
aactgggcagacctgcttcctcctcccccagcacatcctcctccacacagcaatagcgaa
gagtacaacatttctgtagatgaaagctatgaccaagaaatgccatgtcccgtgccacca
gcaaggatgtatttgcaacaagatgaattagaagaggaggaagatgaacgaggccccact
ccccctgttcggggagcagcttcttctccagctgccgtgtcctatagccatcagtccact
gccactctgactccctccccacaggaagaactccagcccatgttacaggattgtccagag
gagactggccacatgcagcaccagcccgacaggagacggcagcctgtgagtcctcctcca
ccaccacggccgatctcccctccacatacctatggctacatttcaggacccctggtctca
gatatggatacggatgcgccagaagaggaagaagacgaagccgacatggaggtagccaag
atgcaaaccagaaggcttttgttacgtgggcttgagcagacacctgcctccagtgttggg
gacctggagagctctgtcacggggtccatgatcaacggctggggctcagcctcagaggag
gacaacatttccagcggacgctccagtgttagttcttcggacggctcctttttcactgat
gctgactttgcccaggcagtcgcagcagcggcagagtatgctggtctgaaagtagcacga
cggcaaatgcaggatgctgctggccgtcgacattttcatgcgtctcagtgccctaggccc
acaagtcccgtgtctacagacagcaacatgagtgccgccgtaatgcagaaaaccagacca
gccaagaaactgaaacaccagccaggacatctgcgcagagaaacctacacagatgatctt
ccaccacctcctgtgccgccacctgctataaagtcacctactgcccaatccaagacacag
ctggaagtacgacctgtagtggtgccaaaactcccttctatggatgcaagaacagacaga
tcatcagacagaaaaggaagcagttacaaggggagagaagtgttggatggaagacaggtt
gttgacatgcgaacaaatccaggtgatcccagagaagcacaggaacagcaaaatgacggg
aaaggacgtggaaacaaggcagcaaaacgagaccttccaccagcaaagactcatctcatc
caagaggatattctaccttattgtagacctacttttccaacatcaaataatcccagagat
cccagttcctcaagctcaatgtcatcaagaggatcaggaagcagacaaagagaacaagca
aatgtaggtcgaagaaatattgcagaaatgcaggtacttggaggatatgaaagaggagaa
gataataatgaagaattagaggaaactgaaagctga

DBGET integrated database retrieval system