KEGG   Homo sapiens (human): 6091Help
Entry
6091              CDS       T01001                                 

Gene name
ROBO1, DUTT1, SAX3
Definition
(RefSeq) roundabout guidance receptor 1
  KO
K06753  
roundabout, axon guidance receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    6091 (ROBO1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   5/3 subfamily
    ROBO1; roundabout, axon guidance receptor 1 [KO:K06753]
     6091 (ROBO1)
    ROBO3; roundabout, axon guidance receptor 3 [KO:K06755]
     6091 (ROBO1)
  Others
   ROBO4; roundabout, axon guidance receptor, homolog 4 (Drosophila) [KO:K06784]
    6091 (ROBO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p12
AA seq 1651 aa AA seqDB search
MKWKHVPFLVMISLLSLSPNHLFLAQLIPDPEDVERGNDHGTPIPTSDNDDNSLGYTGSR
LRQEDFPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVETDKDDPRSHRM
LLPSGSLFFLRIVHGRKSRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVM
VAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERITIRGGKLMITYTRKSDAGKYVC
VGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDG
ELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQEPPHFVVKPRDQ
VVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGDLTITNVQR
SDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTFVLSCVATG
SPVPTILWRKDGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYI
EVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGATPTSYIIEAFS
HASGSSWQTVAENVKTETSAIKGLKPNAIYLFLVRAANAYGISDPSQISDPVKTQDVLPT
SQGVDHKQVQRELGNAVLHLHNPTVLSSSSIEVHWTVDQQSQYIQGYKILYRPSGANHGE
SDWLVFEVRTPAKNSVVIPDLRKGVNYEIKARPFFNEFQGADSEIKFAKTLEEAPSAPPQ
GVTVSKNDGNGTAILVSWQPPPEDTQNGMVQEYKVWCLGNETRYHINKTVDGSTFSVVIP
FLVPGIRYSVEVAASTGAGSGVKSEPQFIQLDAHGNPVSPEDQVSLAQQISDVVKQPAFI
AGIGAACWIILMVFSIWLYRHRKKRNGLTSTYAGIRKVPSFTFTPTVTYQRGGEAVSSGG
RPGLLNISEPAAQPWLADTWPNTGNNHNDCSISCCTAGNGNSDSNLTTYSRPADCIANYN
NQLDNKQTNLMLPESTVYGDVDLSNKINEMKTFNSPNLKDGRFVNPSGQPTPYATTQLIQ
SNLSNNMNNGSGDSGEKHWKPLGQQKQEVAPVQYNIVEQNKLNKDYRANDTVPPTIPYNQ
SYDQNTGGSYNSSDRGSSTSGSQGHKKGARTPKVPKQGGMNWADLLPPPPAHPPPHSNSE
EYNISVDESYDQEMPCPVPPARMYLQQDELEEEEDERGPTPPVRGAASSPAAVSYSHQST
ATLTPSPQEELQPMLQDCPEETGHMQHQPDRRRQPVSPPPPPRPISPPHTYGYISGPLVS
DMDTDAPEEEEDEADMEVAKMQTRRLLLRGLEQTPASSVGDLESSVTGSMINGWGSASEE
DNISSGRSSVSSSDGSFFTDADFAQAVAAAAEYAGLKVARRQMQDAAGRRHFHASQCPRP
TSPVSTDSNMSAAVMQKTRPAKKLKHQPGHLRRETYTDDLPPPPVPPPAIKSPTAQSKTQ
LEVRPVVVPKLPSMDARTDRSSDRKGSSYKGREVLDGRQVVDMRTNPGDPREAQEQQNDG
KGRGNKAAKRDLPPAKTHLIQEDILPYCRPTFPTSNNPRDPSSSSSMSSRGSGSRQREQA
NVGRRNIAEMQVLGGYERGEDNNEELEETES
NT seq 4956 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggaaacatgttccttttttggtcatgatatcactcctcagcttatccccaaat
cacctgtttctggcccagcttattccagaccctgaagatgtagagagggggaacgaccac
gggacgccaatccccacctctgataacgatgacaattcgctgggctatacaggctcccgt
cttcgtcaggaagattttccacctcgcattgttgaacacccttcagacctgattgtctca
aaaggagaacctgcaactttgaactgcaaagctgaaggccgccccacacccactattgaa
tggtacaaagggggagagagagtggagacagacaaagatgaccctcgctcacaccgaatg
ttgctgccgagtggatctttatttttcttacgtatagtacatggacggaaaagtagacct
gatgaaggagtctatgtctgtgtagcaaggaattaccttggagaggctgtgagccacaat
gcatcgctggaagtagccatacttcgggatgacttcagacaaaacccttcggatgtcatg
gttgcagtaggagagcctgcagtaatggaatgccaacctccacgaggccatcctgagccc
accatttcatggaagaaagatggctctccactggatgataaagatgaaagaataactata
cgaggaggaaagctcatgatcacttacacccgtaaaagtgacgctggcaaatatgtttgt
gttggtaccaatatggttggggaacgtgagagtgaagtagccgagctgactgtcttagag
agaccatcatttgtgaagagacccagtaacttggcagtaactgtggatgacagtgcagaa
tttaaatgtgaggcccgaggtgaccctgtacctacagtacgatggaggaaagatgatgga
gagctgcccaaatccagatatgaaatccgagatgatcataccttgaaaattaggaaggtg
acagctggtgacatgggttcatacacttgtgttgcagaaaatatggtgggcaaagctgaa
gcatctgctactctgactgttcaagaacctccacattttgttgtgaaaccccgtgaccag
gttgttgctttgggacggactgtaacttttcagtgtgaagcaaccggaaatcctcaacca
gctattttctggaggagagaagggagtcagaatctacttttctcatatcaaccaccacag
tcatccagccgattttcagtctcccagactggcgacctcacaattactaatgtccagcga
tctgatgttggttattacatctgccagactttaaatgttgctggaagcatcatcacaaag
gcatatttggaagttacagatgtgattgcagatcggcctcccccagttattcgacaaggt
cctgtgaatcagactgtagccgtggatggcactttcgtcctcagctgtgtggccacaggc
agtccagtgcccaccattctgtggagaaaggatggagtcctcgtttcaacccaagactct
cgaatcaaacagttggagaatggagtactgcagatccgatatgctaagctgggtgatact
ggtcggtacacctgcattgcatcaacccccagtggtgaagcaacatggagtgcttacatt
gaagttcaagaatttggagttccagttcagcctccaagacctactgacccaaatttaatc
cctagtgccccatcaaaacctgaagtgacagatgtcagcagaaatacagtcacattatcg
tggcaaccaaatttgaattcaggagcaactccaacatcttatattatagaagccttcagc
catgcatctggtagcagctggcagaccgtagcagagaatgtgaaaacagaaacatctgcc
attaaaggactcaaacctaatgcaatttaccttttccttgtgagggcagctaatgcatat
ggaattagtgatccaagccaaatatcagatccagtgaaaacacaagatgtcctaccaaca
agtcagggggtggaccacaagcaggtccagagagagctgggaaatgctgttctgcacctc
cacaaccccaccgtcctttcttcctcttccatcgaagtgcactggacagtagatcaacag
tctcagtatatacaaggatataaaattctctatcggccatctggagccaaccacggagaa
tcagactggttagtttttgaagtgaggacgccagccaaaaacagtgtggtaatccctgat
ctcagaaagggagtcaactatgaaattaaggctcgccctttttttaatgaatttcaagga
gcagatagtgaaatcaagtttgccaaaaccctggaagaagcacccagtgccccaccccaa
ggtgtaactgtatccaagaatgatggaaacggaactgcaattctagttagttggcagcca
cctccagaagacactcaaaatggaatggtccaagagtataaggtttggtgtctgggcaat
gaaactcgataccacatcaacaaaacagtggatggttccaccttttccgtggtcattccc
tttcttgttcctggaatccgatacagtgtggaagtggcagccagcactggggctgggtct
ggggtaaagagtgagcctcagttcatccagctggatgcccatggaaaccctgtgtcacct
gaggaccaagtcagcctcgctcagcagatttcagatgtggtgaagcagccggccttcata
gcaggtattggagcagcctgttggatcatcctcatggtcttcagcatctggctttatcga
caccgcaagaagagaaacggacttactagtacctacgcgggtatcagaaaagtcccgtct
tttaccttcacaccaacagtaacttaccagagaggaggcgaagctgtcagcagtggaggg
aggcctggacttctcaacatcagtgaacctgccgcgcagccatggctggcagacacgtgg
cctaatactggcaacaaccacaatgactgctccatcagctgctgcacggcaggcaatgga
aacagcgacagcaacctcactacctacagtcgcccagctgattgtatagcaaattataac
aaccaactggataacaaacaaacaaatctgatgctccctgagtcaactgtttatggtgat
gtggaccttagtaacaaaatcaatgagatgaaaaccttcaatagcccaaatctgaaggat
gggcgttttgtcaatccatcagggcagcctactccttacgccaccactcagctcatccag
tcaaacctcagcaacaacatgaacaatggcagcggggactctggcgagaagcactggaaa
ccactgggacagcagaaacaagaagtggcaccagttcagtacaacatcgtggagcaaaac
aagctgaacaaagattatcgagcaaatgacacagttcctccaactatcccatacaaccaa
tcatacgaccagaacacaggaggatcctacaacagctcagaccggggcagtagtacatct
gggagtcaggggcacaagaaaggggcaagaacacccaaggtaccaaaacagggtggcatg
aactgggcagacctgcttcctcctcccccagcacatcctcctccacacagcaatagcgaa
gagtacaacatttctgtagatgaaagctatgaccaagaaatgccatgtcccgtgccacca
gcaaggatgtatttgcaacaagatgaattagaagaggaggaagatgaacgaggccccact
ccccctgttcggggagcagcttcttctccagctgccgtgtcctatagccatcagtccact
gccactctgactccctccccacaggaagaactccagcccatgttacaggattgtccagag
gagactggccacatgcagcaccagcccgacaggagacggcagcctgtgagtcctcctcca
ccaccacggccgatctcccctccacatacctatggctacatttcaggacccctggtctca
gatatggatacggatgcgccagaagaggaagaagacgaagccgacatggaggtagccaag
atgcaaaccagaaggcttttgttacgtgggcttgagcagacacctgcctccagtgttggg
gacctggagagctctgtcacggggtccatgatcaacggctggggctcagcctcagaggag
gacaacatttccagcggacgctccagtgttagttcttcggacggctcctttttcactgat
gctgactttgcccaggcagtcgcagcagcggcagagtatgctggtctgaaagtagcacga
cggcaaatgcaggatgctgctggccgtcgacattttcatgcgtctcagtgccctaggccc
acaagtcccgtgtctacagacagcaacatgagtgccgccgtaatgcagaaaaccagacca
gccaagaaactgaaacaccagccaggacatctgcgcagagaaacctacacagatgatctt
ccaccacctcctgtgccgccacctgctataaagtcacctactgcccaatccaagacacag
ctggaagtacgacctgtagtggtgccaaaactcccttctatggatgcaagaacagacaga
tcatcagacagaaaaggaagcagttacaaggggagagaagtgttggatggaagacaggtt
gttgacatgcgaacaaatccaggtgatcccagagaagcacaggaacagcaaaatgacggg
aaaggacgtggaaacaaggcagcaaaacgagaccttccaccagcaaagactcatctcatc
caagaggatattctaccttattgtagacctacttttccaacatcaaataatcccagagat
cccagttcctcaagctcaatgtcatcaagaggatcaggaagcagacaaagagaacaagca
aatgtaggtcgaagaaatattgcagaaatgcaggtacttggaggatatgaaagaggagaa
gataataatgaagaattagaggaaactgaaagctga

DBGET integrated database retrieval system