KEGG   Homo sapiens (human): 6094Help
Entry
6094              CDS       T01001                                 

Gene name
ROM1, ROM, ROSP1, RP7, TSPAN23
Definition
(RefSeq) retinal outer segment membrane protein 1
  KO
K17344  rod outer segment membrane protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspannin
Motif
Other DBs
NCBI-GeneID: 6094
NCBI-ProteinID: NP_000318
OMIM: 180721
HGNC: 10254
Ensembl: ENSG00000149489
Vega: OTTHUMG00000167528
Pharos: Q03395(Tdark)
UniProt: Q03395
Position
11q12.3
AA seq 351 aa AA seqDB search
MAPVLPLVLPLQPRIRLAQGLWLLSWLLALAGGVILLCSGHLLVQLRHLGTFLAPSCQFP
VLPQAALAAGAVALGTGLVGVGASRASLNAALYPPWRGVLGPLLVAGTAGGGGLLVVALG
LALALPGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGV
QWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFD
PRQPNQNLWAQGCHEVLLEHLQDLAGTLGSMLAVTFLLQALVLLGLRYLQTALEGLGGVI
DAGGETQGYLFPSGLKDMLKTAWLQGGVACRPAPEEAPPGEAPPKEDLSEA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggtgttgcccctggtgctgcccctgcagccccgcatccgcctggcacaaggg
ctctggctcctctcctggctgctggcgctggctggtggcgtcatcctcctctgtagtggg
cacctcctggtccagctaaggcaccttggcaccttcctggctccctcctgtcagttccct
gtcctgccccaggctgccctggcagcgggcgcggtggctctgggcacaggactagtgggt
gtaggagccagccgggcaagtctgaatgcagctctataccctccctggcgaggggtcctg
ggcccgctgctggtggctggcacggctggtgggggggggctcctggtcgtcgccctcggg
ctagccctggctttgcctgggagtctggatgaggcgctggaggagggcctggtgactgcc
ttggctcactacaaggacacagaggtgcctgggcactgtcaggccaaaaggctggtggat
gagctgcaactgaggtaccactgctgcgggcgccacgggtacaaggattggtttggggtc
cagtgggtcagcagccgttacctggatcccggtgaccgggatgtggctgaccggatccag
agcaatgtagaaggcctatacctgactgatggggtccctttctcctgttgcaacccccac
tcaccccggccttgcctgcaaaaccgtctttcagactcctacgcccaccccctgttcgat
ccccgacaacccaaccaaaacctctgggcccaagggtgccatgaggtgctgctggagcac
ttgcaggacttggcaggcacactgggtagcatgctggctgtcaccttcctactgcaggct
ctggtgctccttggcctgcggtacctgcaaacagcactggaggggcttggaggggtcatt
gatgcgggaggagagacccagggctatctctttcccagtgggctgaaagatatgctgaaa
acagcatggctacagggaggggttgcctgcaggccagcacctgaggaggccccaccagga
gaagcacctcccaaggaggatctatctgaggcctag

DBGET integrated database retrieval system