KEGG   Homo sapiens (human): 6094Help
Entry
6094              CDS       T01001                                 

Gene name
ROM1, ROM, ROSP1, RP7, TSPAN23
Definition
(RefSeq) retinal outer segment membrane protein 1
  KO
K17344  
rod outer segment membrane protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13
AA seq 351 aa AA seqDB search
MAPVLPLVLPLQPRIRLAQGLWLLSWLLALAGGVILLCSGHLLVQLRHLGTFLAPSCQFP
VLPQAALAAGAVALGTGLVGVGASRASLNAALYPPWRGVLGPLLVAGTAGGGGLLVVALG
LALALPGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGV
QWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFD
PRQPNQNLWAQGCHEVLLEHLQDLAGTLGSMLAVTFLLQALVLLGLRYLQTALEGLGGVI
DAGGETQGYLFPSGLKDMLKTAWLQGGVACRPAPEEAPPGEAPPKEDLSEA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggtgttgcccctggtgctgcccctgcagccccgcatccgcctggcacaaggg
ctctggctcctctcctggctgctggcgctggctggtggcgtcatcctcctctgtagtggg
cacctcctggtccagctaaggcaccttggcaccttcctggctccctcctgtcagttccct
gtcctgccccaggctgccctggcagcgggcgcggtggctctgggcacaggactagtgggt
gtaggagccagccgggcaagtctgaatgcagctctataccctccctggcgaggggtcctg
ggcccgctgctggtggctggcacggctggtgggggggggctcctggtcgtcgccctcggg
ctagccctggctttgcctgggagtctggatgaggcgctggaggagggcctggtgactgcc
ttggctcactacaaggacacagaggtgcctgggcactgtcaggccaaaaggctggtggat
gagctgcaactgaggtaccactgctgcgggcgccacgggtacaaggattggtttggggtc
cagtgggtcagcagccgttacctggatcccggtgaccgggatgtggctgaccggatccag
agcaatgtagaaggcctatacctgactgatggggtccctttctcctgttgcaacccccac
tcaccccggccttgcctgcaaaaccgtctttcagactcctacgcccaccccctgttcgat
ccccgacaacccaaccaaaacctctgggcccaagggtgccatgaggtgctgctggagcac
ttgcaggacttggcaggcacactgggtagcatgctggctgtcaccttcctactgcaggct
ctggtgctccttggcctgcggtacctgcaaacagcactggaggggcttggaggggtcatt
gatgcgggaggagagacccagggctatctctttcccagtgggctgaaagatatgctgaaa
acagcatggctacagggaggggttgcctgcaggccagcacctgaggaggccccaccagga
gaagcacctcccaaggaggatctatctgaggcctag

DBGET integrated database retrieval system