KEGG   Homo sapiens (human): 6098Help
Entry
6098              CDS       T01001                                 

Gene name
ROS1, MCF3, ROS, c-ros-1
Definition
(RefSeq) ROS proto-oncogene 1, receptor tyrosine kinase (EC:2.7.10.1)
  KO
K05088  
proto-oncogene tyrosine-protein kinase ROS [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Disease
H00014  
Non-small cell lung cancer
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     6098 (ROS1)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Sev family
   6098 (ROS1)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class II (Insulin receptor family)
   6098 (ROS1)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class II (Insulin receptor family)
   6098 (ROS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q22
AA seq 2347 aa AA seqDB search
MKNIYCLIPKLVNFATLGCLWISVVQCTVLNSCLKSCVTNLGQQLDLGTPHNLSEPCIQG
CHFWNSVDQKNCALKCRESCEVGCSSAEGAYEEEVLENADLPTAPFASSIGSHNMTLRWK
SANFSGVKYIIQWKYAQLLGSWTYTKTVSRPSYVVKPLHPFTEYIFRVVWIFTAQLQLYS
PPSPSYRTHPHGVPETAPLIRNIESSSPDTVEVSWDPPQFPGGPILGYNLRLISKNQKLD
AGTQRTSFQFYSTLPNTIYRFSIAAVNEVGEGPEAESSITTSSSAVQQEEQWLFLSRKTS
LRKRSLKHLVDEAHCLRLDAIYHNITGISVDVHQQIVYFSEGTLIWAKKAANMSDVSDLR
IFYRGSGLISSISIDWLYQRMYFIMDELVCVCDLENCSNIEEITPPSISAPQKIVADSYN
GYVFYLLRDGIYRADLPVPSGRCAEAVRIVESCTLKDFAIKPQAKRIIYFNDTAQVFMST
FLDGSASHLILPRIPFADVKSFACENNDFLVTDGKVIFQQDALSFNEFIVGCDLSHIEEF
GFGNLVIFGSSSQLHPLPGRPQELSVLFGSHQALVQWKPPALAIGANVILISDIIELFEL
GPSAWQNWTYEVKVSTQDPPEVTHIFLNISGTMLNVPELQSAMKYKVSVRASSPKRPGPW
SEPSVGTTLVPASEPPFIMAVKEDGLWSKPLNSFGPGEFLSSDIGNVSDMDWYNNSLYYS
DTKGDVFVWLLNGTDISENYHLPSIAGAGALAFEWLGHFLYWAGKTYVIQRQSVLTGHTD
IVTHVKLLVNDMVVDSVGGYLYWTTLYSVESTRLNGESSLVLQTQPWFSGKKVIALTLDL
SDGLLYWLVQDSQCIHLYTAVLRGQSTGDTTITEFAAWSTSEISQNALMYYSGRLFWING
FRIITTQEIGQKTSVSVLEPARFNQFTIIQTSLKPLPGNFSFTPKVIPDSVQESSFRIEG
NASSFQILWNGPPAVDWGVVFYSVEFSAHSKFLASEQHSLPVFTVEGLEPYALFNLSVTP
YTYWGKGPKTSLSLRAPETVPSAPENPRIFILPSGKCCNKNEVVVEFRWNKPKHENGVLT
KFEIFYNISNQSITNKTCEDWIAVNVTPSVMSFQLEGMSPRCFIAFQVRAFTSKGPGPYA
DVVKSTTSEINPFPHLITLLGNKIVFLDMDQNQVVWTFSAERVISAVCYTADNEMGYYAE
GDSLFLLHLHNRSSSELFQDSLVFDITVITIDWISRHLYFALKESQNGMQVFDVDLEHKV
KYPREVKIHNRNSTIISFSVYPLLSRLYWTEVSNFGYQMFYYSIISHTLHRILQPTATNQ
QNKRNQCSCNVTEFELSGAMAIDTSNLEKPLIYFAKAQEIWAMDLEGCQCWRVITVPAML
AGKTLVSLTVDGDLIYWIITAKDSTQIYQAKKGNGAIVSQVKALRSRHILAYSSVMQPFP
DKAFLSLASDTVEPTILNATNTSLTIRLPLAKTNLTWYGITSPTPTYLVYYAEVNDRKNS
SDLKYRILEFQDSIALIEDLQPFSTYMIQIAVKNYYSDPLEHLPPGKEIWGKTKNGVPEA
VQLINTTVRSDTSLIISWRESHKPNGPKESVRYQLAISHLALIPETPLRQSEFPNGRLTL
LVTRLSGGNIYVLKVLACHSEEMWCTESHPVTVEMFNTPEKPYSLVPENTSLQFNWKAPL
NVNLIRFWVELQKWKYNEFYHVKTSCSQGPAYVCNITNLQPYTSYNVRVVVVYKTGENST
SLPESFKTKAGVPNKPGIPKLLEGSKNSIQWEKAEDNGCRITYYILEIRKSTSNNLQNQN
LRWKMTFNGSCSSVCTWKSKNLKGIFQFRVVAANNLGFGEYSGISENIILVGDDFWIPET
SFILTIIVGIFLVVTIPLTFVWHRRLKNQKSAKEGVTVLINEDKELAELRGLAAGVGLAN
ACYAIHTLPTQEEIENLPAFPREKLTLRLLLGSGAFGEVYEGTAVDILGVGSGEIKVAVK
TLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELMEGGDLLTYLRK
ARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVKI
GDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQ
PYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLFRN
FFLNSIYKSRDEANNSGVINESFEGEDGDVICLNSDDIMPVALMETKNREGLNYMVLATE
CGQGEEKSEGPLGSQESESCGLRKEEKEPHADKDFCQEKQVAYCPSGKPEGLNYACLTHS
GYGDGSD
NT seq 7044 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacatttactgtcttattccgaagcttgtcaattttgcaactcttggctgccta
tggatttctgtggtgcagtgtacagttttaaatagctgcctaaagtcgtgtgtaactaat
ctgggccagcagcttgaccttggcacaccacataatctgagtgaaccgtgtatccaagga
tgtcacttttggaactctgtagatcagaaaaactgtgctttaaagtgtcgggagtcgtgt
gaggttggctgtagcagcgcggaaggtgcatatgaagaggaagtactggaaaatgcagac
ctaccaactgctccctttgcttcttccattggaagccacaatatgacattacgatggaaa
tctgcaaacttctctggagtaaaatacatcattcagtggaaatatgcacaacttctggga
agctggacttatactaagactgtgtccagaccgtcctatgtggtcaagcccctgcacccc
ttcactgagtacattttccgagtggtttggatcttcacagcgcagctgcagctctactcc
cctccaagtcccagttacaggactcatcctcatggagttcctgaaactgcacctttgatt
aggaatattgagagctcaagtcccgacactgtggaagtcagctgggatccacctcaattc
ccaggtggacctattttgggttataacttaaggctgatcagcaaaaatcaaaaattagat
gcagggacacagagaaccagtttccagttttactccactttaccaaatactatctacagg
ttttctattgcagcagtaaatgaagttggtgagggtccagaagcagaatctagtattacc
acttcatcttcagcagttcaacaagaggaacagtggctctttttatccagaaaaacttct
ctaagaaagagatctttaaaacatttagtagatgaagcacattgccttcggttggatgct
atataccataatattacaggaatatctgttgatgtccaccagcaaattgtttatttctct
gaaggaactctcatatgggcgaagaaggctgccaacatgtctgatgtatctgacctgaga
attttttacagaggttcaggattaatttcttctatctccatagattggctttatcaaaga
atgtatttcatcatggatgaactggtatgtgtctgtgatttagagaactgctcaaacatc
gaggaaattactccaccctctattagtgcacctcaaaaaattgtggctgattcatacaat
gggtatgtcttttacctcctgagagatggcatttatagagcagaccttcctgtaccatct
ggccggtgtgcagaagctgtgcgtattgtggagagttgcacgttaaaggactttgcaatc
aagccacaagccaagcgaatcatttacttcaatgacactgcccaagtcttcatgtcaaca
tttctggatggctctgcttcccatctcatcctacctcgcatcccctttgctgatgtgaaa
agttttgcttgtgaaaacaatgactttcttgtcacagatggcaaggtcattttccaacag
gatgctttgtcttttaatgaattcatcgtgggatgtgacctgagtcacatagaagaattt
gggtttggtaacttggtcatctttggctcatcctcccagctgcaccctctgccaggccgc
ccgcaggagctttcggtgctgtttggctctcaccaggctcttgttcaatggaagcctcct
gcccttgccataggagccaatgtcatcctgatcagtgatattattgaactctttgaatta
ggcccttctgcctggcagaactggacctatgaggtgaaagtatccacccaagaccctcct
gaagtcactcatattttcttgaacataagtggaaccatgctgaatgtacctgagctgcag
agtgctatgaaatacaaggtttctgtgagagcaagttctccaaagaggccaggcccctgg
tcagagccctcagtgggtactaccctggtgccagctagtgaaccaccatttatcatggct
gtgaaagaagatgggctttggagtaaaccattaaatagctttggcccaggagagttctta
tcctctgatataggaaatgtgtcagacatggattggtataacaacagcctctactacagt
gacacgaaaggcgacgtttttgtgtggctgctgaatgggacggatatctcagagaattat
cacctacccagcattgcaggagcaggggctttagcttttgagtggctgggtcactttctc
tactgggctggaaagacatatgtgatacaaaggcagtctgtgttgacgggacacacagac
attgttacccacgtgaagctattggtgaatgacatggtggtggattcagttggtggatat
ctctactggaccacactctattcagtggaaagcaccagactaaatggggaaagttccctt
gtactacagacacagccttggttttctgggaaaaaggtaattgctctaactttagacctc
agtgatgggctcctgtattggttggttcaagacagtcaatgtattcacctgtacacagct
gttcttcggggacagagcactggggataccaccatcacagaatttgcagcctggagtact
tctgaaatttcccagaatgcactgatgtactatagtggtcggctgttctggatcaatggc
tttaggattatcacaactcaagaaataggtcagaaaaccagtgtctctgttttggaacca
gccagatttaatcagttcacaattattcagacatcccttaagcccctgccagggaacttt
tcctttacccctaaggttattccagattctgttcaagagtcttcatttaggattgaagga
aatgcttcaagttttcaaatcctgtggaatggtccccctgcggtagactggggtgtagtt
ttctacagtgtagaatttagtgctcattctaagttcttggctagtgaacaacactcttta
cctgtatttactgtggaaggactggaaccttatgccttatttaatctttctgtcactcct
tatacctactggggaaagggccccaaaacatctctgtcacttcgagcacctgaaacagtt
ccatcagcaccagagaaccccagaatatttatattaccaagtggaaaatgctgcaacaag
aatgaagttgtggtggaatttaggtggaacaaacctaagcatgaaaatggggtgttaaca
aaatttgaaattttctacaatatatccaatcaaagtattacaaacaaaacatgtgaagac
tggattgctgtcaatgtcactccctcagtgatgtcttttcaacttgaaggcatgagtccc
agatgctttattgccttccaggttagggcctttacatctaaggggccaggaccatatgct
gacgttgtaaagtctacaacatcagaaatcaacccatttcctcacctcataactcttctt
ggtaacaagatagtttttttagatatggatcaaaatcaagttgtgtggacgttttcagca
gaaagagttatcagtgccgtttgctacacagctgataatgagatgggatattatgctgaa
ggggactcactctttcttctgcacttgcacaatcgctctagctctgagcttttccaagat
tcactggtttttgatatcacagttattacaattgactggatttcaaggcacctctacttt
gcactgaaagaatcacaaaatggaatgcaagtatttgatgttgatcttgaacacaaggtg
aaatatcccagagaggtgaagattcacaataggaattcaacaataatttctttttctgta
tatcctcttttaagtcgcttgtattggacagaagtttccaattttggctaccagatgttc
tactacagtattatcagtcacaccttgcaccgaattctgcaacccacagctacaaaccaa
caaaacaaaaggaatcaatgttcttgtaatgtgactgaatttgagttaagtggagcaatg
gctattgatacctctaacctagagaaaccattgatatactttgccaaagcacaagagatc
tgggcaatggatctggaaggctgtcagtgttggagagttatcacagtacctgctatgctc
gcaggaaaaacccttgttagcttaactgtggatggagatcttatatactggatcatcaca
gcaaaggacagcacacagatttatcaggcaaagaaaggaaatggggccatcgtttcccag
gtgaaggccctaaggagtaggcatatcttggcttacagttcagttatgcagccttttcca
gataaagcgtttctgtctctagcttcagacactgtggaaccaactatacttaatgccact
aacactagcctcacaatcagattacctctggccaagacaaacctcacatggtatggcatc
accagccctactccaacatacctggtttattatgcagaagttaatgacaggaaaaacagc
tctgacttgaaatatagaattctggaatttcaggacagtatagctcttattgaagattta
caaccattttcaacatacatgatacagatagctgtaaaaaattattattcagatcctttg
gaacatttaccaccaggaaaagagatttggggaaaaactaaaaatggagtaccagaggca
gtgcagctcattaatacaactgtgcggtcagacaccagcctcattatatcttggagagaa
tctcacaagccaaatggacctaaagaatcagtccgttatcagttggcaatctcacacctg
gccctaattcctgaaactcctctaagacaaagtgaatttccaaatggaaggctcactctc
cttgttactagactgtctggtggaaatatttatgtgttaaaggttcttgcctgccactct
gaggaaatgtggtgtacagagagtcatcctgtcactgtggaaatgtttaacacaccagag
aaaccttattccttggttccagagaacactagtttgcaatttaattggaaggctccattg
aatgttaacctcatcagattttgggttgagctacagaagtggaaatacaatgagttttac
catgttaaaacttcatgcagccaaggtcctgcttatgtctgtaatatcacaaatctacaa
ccttatacttcatataatgtcagagtagtggtggtttataagacgggagaaaatagcacc
tcacttccagaaagctttaagacaaaagctggagtcccaaataaaccaggcattcccaaa
ttactagaagggagtaaaaattcaatacagtgggagaaagctgaagataatggatgtaga
attacatactatatccttgagataagaaagagcacttcaaataatttacagaaccagaat
ttaaggtggaagatgacatttaatggatcctgcagtagtgtttgcacatggaagtccaaa
aacctgaaaggaatatttcagttcagagtagtagctgcaaataatctagggtttggtgaa
tatagtggaatcagtgagaatattatattagttggagatgatttttggataccagaaaca
agtttcatacttactattatagttggaatatttctggttgttacaatcccactgaccttt
gtctggcatagaagattaaagaatcaaaaaagtgccaaggaaggggtgacagtgcttata
aacgaagacaaagagttggctgagctgcgaggtctggcagccggagtaggcctggctaat
gcctgctatgcaatacatactcttccaacccaagaggagattgaaaatcttcctgccttc
cctcgggaaaaactgactctgcgtctcttgctgggaagtggagcctttggagaagtgtat
gaaggaacagcagtggacatcttaggagttggaagtggagaaatcaaagtagcagtgaag
actttgaagaagggttccacagaccaggagaagattgaattcctgaaggaggcacatctg
atgagcaaatttaatcatcccaacattctgaagcagcttggagtttgtctgctgaatgaa
ccccaatacattatcctggaactgatggagggaggagaccttcttacttatttgcgtaaa
gcccggatggcaacgttttatggtcctttactcaccttggttgaccttgtagacctgtgt
gtagatatttcaaaaggctgtgtctacttggaacggatgcatttcattcacagggatctg
gcagctagaaattgccttgtttccgtgaaagactataccagtccacggatagtgaagatt
ggagactttggactcgccagagacatctataaaaatgattactatagaaagagaggggaa
ggcctgctcccagttcggtggatggctccagaaagtttgatggatggaatcttcactact
caatctgatgtatggtcttttggaattctgatttgggagattttaactcttggtcatcag
ccttatccagctcattccaaccttgatgtgttaaactatgtgcaaacaggagggagactg
gagccaccaagaaattgtcctgatgatctgtggaatttaatgacccagtgctgggctcaa
gaacccgaccaaagacctacttttcatagaattcaggaccaacttcagttattcagaaat
tttttcttaaatagcatttataagtccagagatgaagcaaacaacagtggagtcataaat
gaaagctttgaaggtgaagatggcgatgtgatttgtttgaattcagatgacattatgcca
gttgctttaatggaaacgaagaaccgagaagggttaaactatatggtacttgctacagaa
tgtggccaaggtgaagaaaagtctgagggtcctctaggctcccaggaatctgaatcttgt
ggtctgaggaaagaagagaaggaaccacatgcagacaaagatttctgccaagaaaaacaa
gtggcttactgcccttctggcaagcctgaaggcctgaactatgcctgtctcactcacagt
ggatatggagatgggtctgattaa

DBGET integrated database retrieval system