KEGG   Homo sapiens (human): 610Help
Entry
610               CDS       T01001                                 

Gene name
HCN2, BCNG-2, BCNG2, HAC-1
Definition
(RefSeq) hyperpolarization activated cyclic nucleotide gated potassium channel 2
  KO
K04955  
hyperpolarization activated cyclic nucleotide-gated potassium channel 2
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    610 (HCN2)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Brain cyclic nucleotide-gated channel (HCN)
   610 (HCN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 889 aa AA seqDB search
MDARGGGGRPGESPGATPAPGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPPQHPPRAEA
LPPEAADEGGPRGRLRSRDSSCGRPGTPGAASTAKGSPNGECGRGEPQCSPAGPEGPARG
PKVSFSCRGAASGPAPGPGPAEEAGSEEAGPAGEPRGSQASFMQRQFGALLQPGVNKFSL
RMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDET
TAPWIVFNVVSDTFFLMDLVLNFRTGIVIEDNTEIILDPEKIKKKYLRTWFVVDFVSSIP
VDYIFLIVEKGIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDL
ASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPRNCWVSINGMVNHSWSELYSFALFK
AMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKY
KQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVA
SMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMK
LSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRL
DRIGKKNSILLHKVQHDLNSGVFNNQENAIIQEIVKYDREMVQQAELGQRVGLFPPPPPP
PQVTSAIATLQQAAAMSFCPQVARPLVGPLALGSPRLVRRPPPGPAPAAASPGPPPPASP
PGAPASPRAPRTSPYGGLPAAPLAGPALPARRLSRASRPLSASQPSLPHGAPGPAASTRP
ASSSTPRLGPTPAARAAAPSPDRRDSASPGAAGGLDPQDSARSRLSSNL
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgcgcgggggcggcgggcggcccggggagagcccgggcgcgacccccgcgccg
gggccgccgccgccgccgccgcccgcgcccccccaacagcagccgccgccgccgccgccg
cccgcgccccccccgggccccgggcccgcgcccccccagcacccgccccgggccgaggcg
ttgcccccggaggcggcggatgagggcggcccgcggggccggctccgcagccgcgacagc
tcgtgcggccgccccggcaccccgggcgcggcgagcacggccaagggcagcccgaacggc
gagtgcgggcgcggcgagccgcagtgcagccccgcggggcccgagggcccggcgcggggg
cccaaggtgtcgttctcgtgccgcggggcggcctcggggcccgcgccggggccggggccg
gcggaggaggcgggcagcgaggaggcgggcccggcgggggagccgcgcggcagccaggcc
agcttcatgcagcgccagttcggcgcgctcctgcagccgggcgtcaacaagttctcgctg
cggatgttcggcagccagaaggccgtggagcgcgagcaggagcgcgtcaagtcggcgggg
gcctggatcatccacccgtacagcgacttcaggttctactgggacttcaccatgctgctg
ttcatggtgggaaacctcatcatcatcccagtgggcatcaccttcttcaaggatgagacc
actgccccgtggatcgtgttcaacgtggtctcggacaccttcttcctcatggacctggtg
ttgaacttccgcaccggcattgtgatcgaggacaacacggagatcatcctggaccccgag
aagatcaagaagaagtatctgcgcacgtggttcgtggtggacttcgtgtcctccatcccc
gtggactacatcttccttatcgtggagaagggcattgactccgaggtctacaagacggca
cgcgccctgcgcatcgtgcgcttcaccaagatcctcagcctcctgcggctgctgcgcctc
tcacgcctgatccgctacatccatcagtgggaggagatcttccacatgacctatgacctg
gccagcgcggtgatgaggatctgcaatctcatcagcatgatgctgctgctctgccactgg
gacggctgcctgcagttcctggtgcctatgctgcaggacttcccgcgcaactgctgggtg
tccatcaatggcatggtgaaccactcgtggagtgaactgtactccttcgcactcttcaag
gccatgagccacatgctgtgcatcgggtacggccggcaggcgcccgagagcatgacggac
atctggctgaccatgctcagcatgattgtgggtgccacctgctacgccatgttcatcggc
cacgccactgccctcatccagtcgctggactcctcgcggcgccagtaccaggagaagtac
aagcaggtggagcagtacatgtccttccacaagctgccagctgacttccgccagaagatc
cacgactactatgagcaccgttaccagggcaagatgtttgacgaggacagcatcctgggc
gagctcaacgggcccctgcgggaggagatcgtcaacttcaactgccggaagctggtggcc
tccatgccgctgttcgccaacgccgaccccaacttcgtcacggccatgctgaccaagctc
aagttcgaggtcttccagccgggtgactacatcatccgcgaaggcaccatcgggaagaag
atgtacttcatccagcacggcgtggtcagcgtgctcactaagggcaacaaggagatgaag
ctgtccgatggctcctacttcggggagatctgcctgctcacccggggccgccgcacggcg
agcgtgcgggctgacacctactgccgcctctattcgctgagcgtggacaacttcaacgag
gtgctggaggagtaccccatgatgcggcgcgccttcgagacggtggccatcgaccgcctg
gaccgcatcggcaagaagaattccatcctcctgcacaaggtgcagcatgacctcaactcg
ggcgtattcaacaaccaggagaacgccatcatccaggagatcgtcaagtacgaccgcgag
atggtgcagcaggccgagctgggtcagcgcgtgggcctcttcccgccgccgccgccgccg
ccgcaggtcacctcggccatcgccacgctgcagcaggcggcggccatgagcttctgcccg
caggtggcgcggccgctcgtggggccgctggcgctcggctcgccgcgcctcgtgcgccgc
ccgcccccggggcccgcacctgccgccgcctcacccgggcccccgccccccgccagcccc
ccgggcgcgcccgccagcccccgggcaccgcggacctcgccctacggcggcctgcccgcc
gccccccttgctgggcccgccctgcccgcgcgccgcctgagccgcgcgtcgcgcccactg
tccgcctcgcagccctcgctgcctcacggcgcccccggccccgcggcctccacacgcccg
gccagcagctccacaccgcgcttggggcccacgcccgctgcccgggccgccgcgcccagc
ccggaccgcagggactcggcctcacccggcgccgccggcggcctggacccccaggactcc
gcgcgctcgcgcctctcgtccaacttgtga

DBGET integrated database retrieval system