KEGG   Homo sapiens (human): 6118Help
Entry
6118              CDS       T01001                                 

Gene name
RPA2, REPA2, RP-A_p32, RP-A_p34, RPA32
Definition
(RefSeq) replication protein A2
  KO
K10739  replication factor A2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
hsa03440  Homologous recombination
hsa03460  Fanconi anemia pathway
Module
hsa_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    6118 (RPA2)
   03420 Nucleotide excision repair
    6118 (RPA2)
   03430 Mismatch repair
    6118 (RPA2)
   03440 Homologous recombination
    6118 (RPA2)
   03460 Fanconi anemia pathway
    6118 (RPA2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    6118 (RPA2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     6118 (RPA2)
   MMR (mismatch exicision repair)
     6118 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     6118 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon MarR_2
Motif
Other DBs
NCBI-GeneID: 6118
NCBI-ProteinID: NP_002937
OMIM: 179836
HGNC: 10290
Ensembl: ENSG00000117748
Vega: OTTHUMG00000003915
Pharos: P15927(Tbio)
UniProt: P15927
Structure
PDB: 

Jmol
Position
1p35.3
AA seq 270 aa AA seqDB search
MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLV
DEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVV
PPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGR
APISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVS
SIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacagtggattcgaaagctatggcagctcctcatacgggggagccggcggctac
acgcagtccccggggggctttggatcgcccgcaccttctcaagccgaaaagaaatcaaga
gcccgagcccagcacattgtgccctgtactatatctcagctgctttctgccactttggtt
gatgaagtgttcagaattgggaatgttgagatttcacaggtcactattgtggggatcatc
agacatgcagagaaggctccaaccaacattgtttacaaaatagatgacatgacagctgca
cccatggacgttcgccagtgggttgacacagatgacaccagcagtgaaaacactgtggtt
cctccagaaacatatgtgaaagtggcaggccacctgagatcttttcagaacaaaaagagc
ctggtagcctttaagatcatgcccctggaggatatgaatgagttcaccacacatattctg
gaagtgatcaatgcacacatggtactaagcaaagccaacagccagccctcagcagggaga
gcacctatcagcaatccaggaatgagtgaagcagggaactttggtgggaatagcttcatg
ccagcaaatggcctcactgtggcccaaaaccaggtgttgaatttgattaaggcttgtcca
agacctgaagggttgaactttcaggatctcaagaaccagctgaaacacatgtctgtatcc
tcaatcaagcaagctgtggattttctgagcaatgaggggcacatctattctactgtggat
gatgaccattttaaatccacagatgcagaataa

DBGET integrated database retrieval system