KEGG   Homo sapiens (human): 6118Help
Entry
6118              CDS       T01001                                 

Gene name
RPA2, REPA2, RPA32
Definition
replication protein A2, 32kDa
Orthology
K10739  
replication factor A2
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:hsa03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:hsa03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:hsa03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hsa03440]
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:hsa03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p35
AA seq 174 aa AA seqDB search
MTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFT
THILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLI
KACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgacagctgcacccatggacgttcgccagtgggttgacacagatgacaccagcagtgaa
aacactgtggttcctccagaaacatatgtgaaagtggcaggccacctgagatcttttcag
aacaaaaagagcctggtagcctttaagatcatgcccctggaggatatgaatgagttcacc
acacatattctggaagtgatcaatgcacacatggtactaagcaaagccaacagccagccc
tcagcagggagagcacctatcagcaatccaggaatgagtgaagcagggaactttggtggg
aatagcttcatgccagcaaatggcctcactgtggcccaaaaccaggtgttgaatttgatt
aaggcttgtccaagacctgaagggttgaactttcaggatctcaagaaccagctgaaacac
atgtctgtatcctcaatcaagcaagctgtggattttctgagcaatgaggggcacatctat
tctactgtggatgatgaccattttaaatccacagatgcagaataa

DBGET integrated database retrieval system