KEGG   Homo sapiens (human): 6118Help
Entry
6118              CDS       T01001                                 

Gene name
RPA2, REPA2, RP-A_p32, RP-A_p34, RPA32
Definition
(RefSeq) replication protein A2
  KO
K10739  
replication factor A2
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    6118 (RPA2)
   03420 Nucleotide excision repair
    6118 (RPA2)
   03430 Mismatch repair
    6118 (RPA2)
   03440 Homologous recombination
    6118 (RPA2)
   03460 Fanconi anemia pathway
    6118 (RPA2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    6118 (RPA2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     6118 (RPA2)
   MMR (mismatch exicision repair)
     6118 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     6118 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p35
AA seq 270 aa AA seqDB search
MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLV
DEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVV
PPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGR
APISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVS
SIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacagtggattcgaaagctatggcagctcctcatacgggggagccggcggctac
acgcagtccccggggggctttggatcgcccgcaccttctcaagccgaaaagaaatcaaga
gcccgagcccagcacattgtgccctgtactatatctcagctgctttctgccactttggtt
gatgaagtgttcagaattgggaatgttgagatttcacaggtcactattgtggggatcatc
agacatgcagagaaggctccaaccaacattgtttacaaaatagatgacatgacagctgca
cccatggacgttcgccagtgggttgacacagatgacaccagcagtgaaaacactgtggtt
cctccagaaacatatgtgaaagtggcaggccacctgagatcttttcagaacaaaaagagc
ctggtagcctttaagatcatgcccctggaggatatgaatgagttcaccacacatattctg
gaagtgatcaatgcacacatggtactaagcaaagccaacagccagccctcagcagggaga
gcacctatcagcaatccaggaatgagtgaagcagggaactttggtgggaatagcttcatg
ccagcaaatggcctcactgtggcccaaaaccaggtgttgaatttgattaaggcttgtcca
agacctgaagggttgaactttcaggatctcaagaaccagctgaaacacatgtctgtatcc
tcaatcaagcaagctgtggattttctgagcaatgaggggcacatctattctactgtggat
gatgaccattttaaatccacagatgcagaataa

DBGET integrated database retrieval system