KEGG   Homo sapiens (human): 6123Help
Entry
6123              CDS       T01001                                 

Gene name
RPL3L
Definition
ribosomal protein L3-like
Orthology
K02925  
large subunit ribosomal protein L3e
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome
Module
Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    6123 (RPL3L)
Ribosome [BR:hsa03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    6123 (RPL3L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
UniProt: 
Position
16p13.3
AA seq 407 aa AA seqDB search
MSHRKFSAPRHGHLGFLPHKRSHRHRGKVKTWPRDDPSQPVHLTAFLGYKAGMTHTLREV
HRPGLKISKREEVEAVTIVETPPLVVVGVVGYVATPRGLRSFKTIFAEHLSDECRRRFYK
DWHKSKKKAFTKACKRWRDTDGKKQLQKDFAAMKKYCKVIRVIVHTQMKLLPFRQKKAHI
MEIQLNGGTVAEKVAWAQARLEKQVPVHSVFSQSEVIDVIAVTKGRGVKGVTSRWHTKKL
PRKTHKGLRKVACIGAWHPARVGCSIARAGQKGYHHRTELNKKIFRIGRGPHMEDGKLVK
NNASTSYDVTAKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKSLLVHHSRQAV
ENIELKFIDTTSKFGHGRFQTAQEKRAFMGPQKKHLEKETPETSGDL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaccggaagttttccgcccctcggcacggacacctgggcttcctgccccataag
aggagccaccggcaccggggcaaggtgaagacgtggccgcgggatgaccccagccagccc
gtgcacctcacggccttcctgggctacaaggcgggcatgacccacaccctgcgggaggtg
caccggccggggctcaaaatttccaaacgggaggaggtggaggcggtgacaattgtagaa
acgccgcccctagtggtggtgggcgtggtgggctacgtggccacccctcgaggtctccgg
agcttcaagaccatctttgcagaacacctcagtgatgagtgccggcgccgattctacaag
gactggcacaagagcaagaagaaagccttcaccaaggcctgcaagaggtggcgggacaca
gacgggaaaaagcagctacagaaggacttcgccgccatgaagaagtactgcaaggtcatt
cgggtcattgtccacactcagatgaaactgctgcccttccggcagaagaaggcccacatc
atggagatccagctgaacggtggcacggtggccgagaaggtggcctgggcccaggcccgg
ctggagaagcaggtgcccgtgcacagcgtgttcagccagagtgaggtcattgatgtcatt
gctgtcaccaagggtcgaggcgtcaaaggggtcacaagccgctggcataccaagaagctg
ccgcggaagacccataagggcctgcgcaaggtggcctgcattggcgcctggcaccccgcc
cgcgtgggctgctccattgctcgggccgggcagaagggctatcaccaccgcacggagctc
aacaagaagatcttccgcatcggcaggggcccgcacatggaggacgggaagctggtgaag
aacaatgcatccaccagctacgacgtgactgccaagtccatcacaccgctgggtggcttc
ccccactacggggaagtgaacaacgacttcgtcatgctgaagggttgtattgctggtacc
aagaagcgggtcattacgctgagaaagtccctcctggtgcatcacagtcgccaagccgtg
gagaatattgagctcaagttcattgacaccacctccaagttcggccatggccgcttccag
acagcccaagagaagagggccttcatgggcccccaaaagaagcatctggagaaggaaacg
ccggagacctcgggagacttgtag

DBGET integrated database retrieval system