KEGG   Homo sapiens (human): 6123Help
Entry
6123              CDS       T01001                                 

Gene name
RPL3L
Definition
(RefSeq) ribosomal protein L3 like
  KO
K02925  
large subunit ribosomal protein L3e
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome
Module
Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    6123 (RPL3L)
Ribosome [BR:hsa03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    6123 (RPL3L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 407 aa AA seqDB search
MSHRKFSAPRHGHLGFLPHKRSHRHRGKVKTWPRDDPSQPVHLTAFLGYKAGMTHTLREV
HRPGLKISKREEVEAVTIVETPPLVVVGVVGYVATPRGLRSFKTIFAEHLSDECRRRFYK
DWHKSKKKAFTKACKRWRDTDGKKQLQKDFAAMKKYCKVIRVIVHTQMKLLPFRQKKAHI
MEIQLNGGTVAEKVAWAQARLEKQVPVHSVFSQSEVIDVIAVTKGRGVKGVTSRWHTKKL
PRKTHKGLRKVACIGAWHPARVGCSIARAGQKGYHHRTELNKKIFRIGRGPHMEDGKLVK
NNASTSYDVTAKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKSLLVHHSRQAV
ENIELKFIDTTSKFGHGRFQTAQEKRAFMGPQKKHLEKETPETSGDL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaccggaagttttccgcccctcggcacggacacctgggcttcctgccccataag
aggagccaccggcaccggggcaaggtgaagacgtggccgcgggatgaccccagccagccc
gtgcacctcacggccttcctgggctacaaggcgggcatgacccacaccctgcgggaggtg
caccggccggggctcaaaatttccaaacgggaggaggtggaggcggtgacaattgtagaa
acgccgcccctagtggtggtgggcgtggtgggctacgtggccacccctcgaggtctccgg
agcttcaagaccatctttgcagaacacctcagtgatgagtgccggcgccgattctacaag
gactggcacaagagcaagaagaaagccttcaccaaggcctgcaagaggtggcgggacaca
gacgggaaaaagcagctacagaaggacttcgccgccatgaagaagtactgcaaggtcatt
cgggtcattgtccacactcagatgaaactgctgcccttccggcagaagaaggcccacatc
atggagatccagctgaacggtggcacggtggccgagaaggtggcctgggcccaggcccgg
ctggagaagcaggtgcccgtgcacagcgtgttcagccagagtgaggtcattgatgtcatt
gctgtcaccaagggtcgaggcgtcaaaggggtcacaagccgctggcataccaagaagctg
ccgcggaagacccataagggcctgcgcaaggtggcctgcattggcgcctggcaccccgcc
cgcgtgggctgctccattgctcgggccgggcagaagggctatcaccaccgcacggagctc
aacaagaagatcttccgcatcggcaggggcccgcacatggaggacgggaagctggtgaag
aacaatgcatccaccagctacgacgtgactgccaagtccatcacaccgctgggtggcttc
ccccactacggggaagtgaacaacgacttcgtcatgctgaagggttgtattgctggtacc
aagaagcgggtcattacgctgagaaagtccctcctggtgcatcacagtcgccaagccgtg
gagaatattgagctcaagttcattgacaccacctccaagttcggccatggccgcttccag
acagcccaagagaagagggccttcatgggcccccaaaagaagcatctggagaaggaaacg
ccggagacctcgggagacttgtag

DBGET integrated database retrieval system