KEGG   Homo sapiens (human): 6134Help
Entry
6134              CDS       T01001                                 

Gene name
RPL10, AUTSX5, DXS648, DXS648E, L10, MRXS35, NOV, QM
Definition
(RefSeq) ribosomal protein L10
  KO
K02866  
large subunit ribosomal protein L10e
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome
Module
Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    6134 (RPL10)
Ribosome [BR:hsa03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    6134 (RPL10)
  Archaea
    6134 (RPL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P27635(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
Xq28
AA seq 214 aa AA seqDB search
MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQL
SSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFG
KPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADE
FEDMVAEKRLIPDGCGVKYIPSRGPLDKWRALHS
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgggccgccgccccgcccgttgttaccggtattgtaagaacaagccgtacccaaagtct
cgcttctgccgaggtgtccctgatgccaagattcgcatttttgacctggggcggaaaaag
gcaaaagtggatgagtttccgctttgtggccacatggtgtcagatgaatatgagcagctg
tcctctgaagccctggaggctgcccgaatttgtgccaataagtacatggtaaaaagttgt
ggcaaagatggcttccatatccgggtgcggctccaccccttccacgtcatccgcatcaac
aagatgttgtcctgtgctggggctgacaggctccaaacaggcatgcgaggtgcctttgga
aagccccagggcactgtggccagggttcacattggccaagttatcatgtccatccgcacc
aagctgcagaacaaggagcatgtgattgaggccctgcgcagggccaagttcaagtttcct
ggccgccagaagatccacatctcaaagaagtggggcttcaccaagttcaatgctgatgaa
tttgaagacatggtggctgaaaagcggctcatcccagatggctgtggggtcaagtacatc
cccagtcgtggccctctggacaagtggcgggccctgcactcatga

DBGET integrated database retrieval system