KEGG   Homo sapiens (human): 6134Help
Entry
6134              CDS       T01001                                 

Gene name
RPL10, AUTSX5, DXS648, DXS648E, L10, NOV, QM
Definition
(RefSeq) ribosomal protein L10 (EC:3.6.5.3)
  KO
K02866  
large subunit ribosomal protein L10e
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome
Module
Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    6134 (RPL10)
Ribosome [BR:hsa03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    6134 (RPL10)
  Archaea
    6134 (RPL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 216 aa AA seqDB search
MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQL
SSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRSTSQRSGASP
SSMLMNLKTWWLKSGSSQMAVGSSTSPVVALWTSGGPCTHEGFQCAAPLLILTNKFYFLS
TYVFVSTFLTGKELPLGTFGSLPFHFRNRLTTQPCS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgggccgccgccccgcccgttgttaccggtattgtaagaacaagccgtacccaaagtct
cgcttctgccgaggtgtccctgatgccaagattcgcatttttgacctggggcggaaaaag
gcaaaagtggatgagtttccgctttgtggccacatggtgtcagatgaatatgagcagctg
tcctctgaagccctggaggctgcccgaatttgtgccaataagtacatggtaaaaagttgt
ggcaaagatggcttccatatccgggtgcggctccaccccttccacgtcatccgcatcaac
aagatgttgtcctgtgctggggctgacagatccacatctcaaagaagtggggcttcacca
agttcaatgctgatgaatttgaagacatggtggctgaaaagcggctcatcccagatggct
gtggggtcaagtacatccccagtcgtggccctctggacaagtggcgggccctgcactcat
gagggcttccaatgtgctgcccccctcttaatactcaccaataaattctacttcctgtcc
acctatgtctttgtatctacattcttgacggggaaggaacttcctctgggaacctttggg
tcattgccctttcacttcagaaacaggttgacaactcagccctgctcatga

DBGET integrated database retrieval system