KEGG   Homo sapiens (human): 6134Help
Entry
6134              CDS       T01001                                 

Gene name
RPL10, AUTSX5, DXS648, DXS648E, L10, NOV, QM
Definition
ribosomal protein L10
Orthology
K02866  
large subunit ribosomal protein L10e
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome
Module
Ribosome, eukaryotes
Class
Genetic Information Processing; Translation; Ribosome [PATH:hsa03010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 216 aa AA seqDB search
MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQL
SSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRSTSQRSGASP
SSMLMNLKTWWLKSGSSQMAVGSSTSPIVALWTSGGPCTHEGFQCAAPLLILTNKFYFLS
TYVFVSTFLTGKELPLGTFGSLPFHFRNRLTTQPCS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgggccgccgccccgcccgttgttaccggtattgtaagaacaagccgtacccaaagtct
cgcttctgccgaggtgtccctgatgccaagattcgcatttttgacctggggcggaaaaag
gcaaaagtggatgagtttccgctttgtggccacatggtgtcagatgaatatgagcagctg
tcctctgaagccctggaggctgcccgaatttgtgccaataagtacatggtaaaaagttgt
ggcaaagatggcttccatatccgggtgcggctccaccccttccacgtcatccgcatcaac
aagatgttgtcctgtgctggggctgacagatccacatctcaaagaagtggggcttcacca
agttcaatgctgatgaatttgaagacatggtggctgaaaagcggctcatcccagatggct
gtggggtcaagtacatccccaatcgtggccctctggacaagtggcgggccctgcactcat
gagggcttccaatgtgctgcccccctcttaatactcaccaataaattctacttcctgtcc
acctatgtctttgtatctacattcttgacggggaaggaacttcctctgggaacctttggg
tcattgccctttcacttcagaaacaggttgacaactcagccctgctcatga

DBGET integrated database retrieval system