KEGG   Homo sapiens (human): 6136Help
Entry
6136              CDS       T01001                                 

Gene name
RPL12, L12
Definition
ribosomal protein L12
Orthology
K02870  
large subunit ribosomal protein L12e
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome
Module
Ribosome, eukaryotes
Class
Genetic Information Processing; Translation; Ribosome [PATH:hsa03010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34
AA seq 165 aa AA seqDB search
MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITV
KLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRS
LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaagttcgaccccaacgagatcaaagtcgtatacctgaggtgcaccggaggt
gaagtcggtgccacttctgccctggcccccaagatcggccccctgggtctgtctccaaaa
aaagttggtgatgacattgccaaggcaacgggtgactggaagggcctgaggattacagtg
aaactgaccattcagaacagacaggcccagattgaggtggtgccttctgcctctgccctg
atcatcaaagccctcaaggaaccaccaagagacagaaagaaacagaaaaacattaaacac
agtgggaatatcacttttgatgagattgtcaacattgctcgacagatgcggcaccgatcc
ttagccagagaactctctggaaccattaaagagatcctggggactgcccagtcagtgggc
tgtaatgttgatggccgccatcctcatgacatcatcgatgacatcaacagtggtgctgtg
gaatgcccagccagttaa

DBGET integrated database retrieval system