KEGG   Homo sapiens (human): 6175Help
Entry
6175              CDS       T01001                                 

Gene name
RPLP0, L10E, LP0, P0, PRLP0, RPP0
Definition
(RefSeq) ribosomal protein lateral stalk subunit P0
  KO
K02941  
large subunit ribosomal protein LP0
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome
Module
Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    6175 (RPLP0)
Ribosome [BR:hsa03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    6175 (RPLP0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.2
AA seq 317 aa AA seqDB search
MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTM
MRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCE
VTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNI
SPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHS
IINGYKRVLALSVETDYTFPLAEKVKAFLADPSAFVAAAPVAAATTAAPAAAAAPAKVEA
KEESEESDEDMGFGLFD
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcccagggaagacagggcgacctggaagtccaactacttccttaagatcatccaacta
ttggatgattatccgaaatgtttcattgtgggagcagacaatgtgggctccaagcagatg
cagcagatccgcatgtcccttcgcgggaaggctgtggtgctgatgggcaagaacaccatg
atgcgcaaggccatccgagggcacctggaaaacaacccagctctggagaaactgctgcct
catatccgggggaatgtgggctttgtgttcaccaaggaggacctcactgagatcagggac
atgttgctggccaataaggtgccagctgctgcccgtgctggtgccattgccccatgtgaa
gtcactgtgccagcccagaacactggtctcgggcccgagaagacctcctttttccaggct
ttaggtatcaccactaaaatctccaggggcaccattgaaatcctgagtgatgtgcagctg
atcaagactggagacaaagtgggagccagcgaagccacgctgctgaacatgctcaacatc
tcccccttctcctttgggctggtcatccagcaggtgttcgacaatggcagcatctacaac
cctgaagtgcttgatatcacagaggaaactctgcattctcgcttcctggagggtgtccgc
aatgttgccagtgtctgtctgcagattggctacccaactgttgcatcagtaccccattct
atcatcaacgggtacaaacgagtcctggccttgtctgtggagacggattacaccttccca
cttgctgaaaaggtcaaggccttcttggctgatccatctgcctttgtggctgctgcccct
gtggctgctgccaccacagctgctcctgctgctgctgcagccccagctaaggttgaagcc
aaggaagagtcggaggagtcggacgaggatatgggatttggtctctttgactaa

DBGET integrated database retrieval system