KEGG   Homo sapiens (human): 6192Help
Entry
6192              CDS       T01001                                 

Gene name
RPS4Y1, RPS4Y, S4
Definition
ribosomal protein S4, Y-linked 1
Orthology
K02987  
small subunit ribosomal protein S4e
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome
Module
Ribosome, eukaryotes
Class
Genetic Information Processing; Translation; Ribosome [PATH:hsa03010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Yp11.3
AA seq 263 aa AA seqDB search
MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDE
VKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAK
YKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNL
CMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPR
GKGIRLTVAEERDKRLATKQSSG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcccggggccccaagaagcacttaaagcgtgttgcagcgccgaagcattggatgctt
gacaaactaacgggtgtatttgcacctcgtccatcgacaggtccccacaagctgagggaa
tgtcttcctctgatcgtcttcctcaggaatagactcaagtatgcgttgactggagatgag
gtaaagaagatatgtatgcaacgtttcatcaaaattgatggcaaggttcgagtggatgtc
acataccctgctggattcatggatgtcatcagcatcgagaagacaggtgaacatttccgc
ctggtctatgacaccaagggccgttttgctgttcaccgcatcacagtggaagaggcaaag
tacaagttgtgcaaagtgaggaagattactgtgggagtgaagggaatccctcacctggtg
actcatgatgctcgaaccatccgctacccagatcctgtcatcaaggtgaacgatactgtg
cagattgatttagggactggcaagataatcaactttatcaaatttgatacaggcaatttg
tgtatggtgattggtggagccaacctcggtcgtgttggtgtgatcaccaacagggaaaga
catcctggttcttttgatgtggtgcatgtgaaggatgccaatggcaacagctttgccacg
aggctttccaacatttttgtcattggcaatggcaataaaccttggatttccctgcccagg
ggaaagggcattcgacttactgttgctgaagagagagataagaggctggccaccaaacag
agcagtggctaa

DBGET integrated database retrieval system