KEGG   Homo sapiens (human): 6195Help
Entry
6195              CDS       T01001                                 

Gene name
RPS6KA1, HU-1, MAPKAPK1A, RSK, RSK1, p90Rsk
Definition
(RefSeq) ribosomal protein S6 kinase A1 (EC:2.7.11.1)
  KO
K04373  
ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Oocyte meiosis
mTOR signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Progesterone-mediated oocyte maturation
Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    6195 (RPS6KA1)
   04150 mTOR signaling pathway
    6195 (RPS6KA1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    6195 (RPS6KA1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    6195 (RPS6KA1)
  Nervous system
   04720 Long-term potentiation
    6195 (RPS6KA1)
   04722 Neurotrophin signaling pathway
    6195 (RPS6KA1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    6195 (RPS6KA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6195 (RPS6KA1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  RSK family [OT]
   6195 (RPS6KA1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     6195 (RPS6KA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p
AA seq 735 aa AA seqDB search
MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPS
HFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVN
HPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHS
LGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHS
HSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRN
PANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSRTP
KDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSDGYVV
KETIGVGSYSECKRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPNIITLKDVYD
DGKHVYLVTELMRGGELLDKILRQKFFSEREASFVLHTIGKTVEYLHSQGVVHRDLKPSN
ILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSL
GILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDP
HQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESS
ILAQRRVRKLPSTTL
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcgcccagctcaaggagccctggccgctcatggagctagtgcctctggacccg
gagaatggacagacctcaggggaagaagctggacttcagccgtccaaggatgagggcgtc
ctcaaggagatctccatcacgcaccacgtcaaggctggctctgagaaggctgatccatcc
catttcgagctcctcaaggttctgggccagggatcctttggcaaagtcttcctggtgcgg
aaagtcacccggcctgacagtgggcacctgtatgctatgaaggtgctgaagaaggcaacg
ctgaaagtacgtgaccgcgtccggaccaagatggagagagacatcctggctgatgtaaat
cacccattcgtggtgaagctgcactatgccttccagaccgagggcaagctctatctcatt
ctggacttcctgcgtggtggggacctcttcacccggctctcaaaagaggtgatgttcacg
gaggaggatgtgaagttttacctggccgagctggctctgggcctggatcacctgcacagc
ctgggtatcatttacagagacctcaagcctgagaacatccttctggatgaggagggccac
atcaaactcactgactttggcctgagcaaagaggccattgaccacgagaagaaggcctat
tctttctgcgggacagtggagtacatggcccctgaggtcgtcaaccgccagggccactcc
catagtgcggactggtggtcctatggggtgttgatgtttgagatgctgacgggctccctg
cccttccaggggaaggaccggaaggagaccatgacactgattctgaaggcgaagctaggc
atgccccagtttctgagcactgaagcccagagcctcttgcgggccctgttcaagcggaat
cctgccaaccggctcggctccggccctgatggggcagaggaaatcaagcggcatgtcttc
tactccaccattgactggaataagctataccgtcgtgagatcaagccacccttcaagcca
gcagtggctcagcctgatgacaccttctactttgacaccgagttcacgtcccgcacaccc
aaggattccccaggcatcccccccagcgctggggcccatcagctgttccggggcttcagc
ttcgtggccaccggcctgatggaagacgacggcaagcctcgtgccccgcaggcacccctg
cactcggtggtacagcaactccatgggaagaacctggtttttagtgacggctacgtggta
aaggagacaattggtgtgggctcctactctgagtgcaagcgctgtgtccacaaggccacc
aacatggagtatgctgtcaaggtcattgataagagcaagcgggatccttcagaagagatt
gagattcttctgcggtatggccagcaccccaacatcatcactctgaaagatgtgtatgat
gatggcaaacacgtgtacctggtgacagagctgatgcggggtggggagctgctggacaag
atcctgcggcagaagttcttctcagagcgggaggccagctttgtcctgcacaccattggc
aaaactgtggagtatctgcactcacagggggttgtgcacagggacctgaagcccagcaac
atcctgtatgtggacgagtccgggaatcccgagtgcctgcgcatctgtgactttggtttt
gccaaacagctgcgggctgagaatgggctcctcatgacaccttgctacacagccaacttt
gtggcgcctgaggtgctgaagcgccagggctacgatgaaggctgcgacatctggagcctg
ggcattctgctgtacaccatgctggcaggatatactccatttgccaacggtcccagtgac
acaccagaggaaatcctaacccggatcggcagtgggaagtttaccctcagtgggggaaat
tggaacacagtttcagagacagccaaggacctggtgtccaagatgctacacgtggatccc
caccagcgcctcacagctaagcaggttctgcagcatccatgggtcacccagaaagacaag
cttccccaaagccagctgtcccaccaggacctacagcttgtgaagggagccatggctgcc
acgtactccgcactcaacagctccaagcccaccccccagctgaagcccatcgagtcatcc
atcctggcccagcggcgagtgaggaagttgccatccaccaccctgtga

DBGET integrated database retrieval system