KEGG   Homo sapiens (human): 6196Help
Entry
6196              CDS       T01001                                 

Gene name
RPS6KA2, HU-2, MAPKAPK1C, RSK, RSK3, S6K-alpha, S6K-alpha2, p90-RSK3, p90RSK2, pp90RSK3
Definition
(RefSeq) ribosomal protein S6 kinase A2 (EC:2.7.11.1)
  KO
K04373  
p90 ribosomal S6 kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Oocyte meiosis
mTOR signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Progesterone-mediated oocyte maturation
Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    6196 (RPS6KA2)
   04150 mTOR signaling pathway
    6196 (RPS6KA2)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    6196 (RPS6KA2)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    6196 (RPS6KA2)
  Nervous system
   04720 Long-term potentiation
    6196 (RPS6KA2)
   04722 Neurotrophin signaling pathway
    6196 (RPS6KA2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    6196 (RPS6KA2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6196 (RPS6KA2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  RSK family [OT]
   6196 (RPS6KA2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     6196 (RPS6KA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q27
AA seq 733 aa AA seqDB search
MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRLEEEGVVKEIDISHHVKEGFEKADPSQFE
LLKVLGQGSYGKVFLVRKVKGSDAGQLYAMKVLKKATLKVRDRVRSKMERDILAEVNHPF
IVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGI
IYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSA
DWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQFLSGEAQSLLRALFKRNPCN
RLGAGIDGVEEIKRHPFFVTIDWNTLYRKEIKPPFKPAVGRPEDTFHFDPEFTARTPTDS
PGVPPSANAHHLFRGFSFVASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIKED
IGVGSYSVCKRCVHKATDTEYAVKIIDKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGK
FVYLVMELMRGGELLDRILRQRYFSEREASDVLCTITKTMDYLHSQGVVHRDLKPSNILY
RDESGSPESIRVCDFGFAKQLRAGNGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGIL
LYTMLAGFTPFANGPDDTPEEILARIGSGKYALSGGNWDSISDAAKDVVSKMLHVDPHQR
LTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLA
QRRGMKRLTSTRL
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggacctgagcatgaagaagttcgccgtgcgcaggttcttctctgtgtacctgcgcagg
aagtcgcgctccaagagctccagcctgagccggctcgaggaagaaggcgtcgtgaaggag
atagacatcagccatcatgtgaaggagggctttgagaaggcagatccttcccagtttgag
ctgctgaaggttttaggacaaggatcctatggaaaggtgttcctggtgaggaaggtgaag
gggtccgacgctgggcagctctacgccatgaaggtccttaagaaagccaccctaaaagtt
cgggaccgagtgagatcgaagatggagagagacatcttggcagaagtgaatcaccccttc
attgtgaagcttcattatgcctttcagacggaaggaaagctctacctgatcctggacttc
ctgcggggaggggacctcttcacccggctctccaaagaggtcatgttcacggaggaggat
gtcaagttctacctggctgagctggccttggctttagaccatctccacagcctggggatc
atctacagagatctgaagcctgagaacatcctcctggatgaagaggggcacattaagatc
acagatttcggcctgagtaaggaggccattgaccacgacaagagagcgtactccttctgc
gggacgatcgagtacatggcgcccgaggtggtgaaccggcgaggacacacgcagagtgcc
gactggtggtccttcggcgtgctcatgtttgagatgctcacggggtccctgccgttccag
gggaaggacaggaaggagaccatggctctcatcctcaaagccaagctggggatgccgcag
ttcctcagtggggaggcacagagtttgctgcgagctctcttcaaacggaacccctgcaac
cggctgggtgctggcattgacggagtggaggaaattaagcgccatcccttctttgtgacc
atagactggaacacgctgtaccggaaggagatcaagccaccgttcaaaccagcagtgggc
aggcctgaggacaccttccactttgaccccgagttcacagcgcggacgcccacagactct
cctggcgtccccccgagtgcaaacgctcatcacctgtttagaggattcagctttgtggcc
tcaagcctgatccaggagccctcacagcaagatctgcacaaagtcccagttcacccaatc
gtgcagcagttacacgggaacaacatccacttcaccgatggctacgagatcaaggaggac
atcggggtgggctcctactcagtgtgcaagcgatgtgtgcataaagccacagacaccgag
tatgccgtgaagatcattgataagagcaagagagacccctcggaagagattgagatcctc
ctgcggtacggccagcacccgaacatcatcaccctcaaggatgtctatgatgatggcaag
tttgtgtacctggtaatggagctgatgcgtggtggggagctcctggaccgcatcctccgg
cagagatacttctcggagcgcgaagccagtgacgtcctgtgcaccatcaccaagaccatg
gactacctccattcccagggggttgttcatcgagacctgaagccgagtaacatcctgtac
agggatgagtcggggagcccagaatccatccgagtctgcgacttcggctttgccaagcag
ctgcgcgcggggaacgggctgctcatgacaccctgctacacggccaatttcgtggccccg
gaggtcctgaagcgtcaaggctatgatgcggcgtgtgacatctggagtttggggatcctg
ttgtacaccatgctggcaggatttaccccttttgcaaatgggccagacgatacccctgag
gagattctggcgcggatcggcagtgggaagtatgccctttctgggggaaactgggactcg
atatctgacgcagctaaagacgtcgtgtccaagatgctccacgtggaccctcatcagcgc
ctgacggcgatgcaagtgctcaaacacccgtgggtggtcaacagagagtacctgtcccca
aaccagctcagccgacaggacgtgcacctggtgaagggcgcgatggccgccacctacttt
gctctaaacagaacacctcaggccccgcggctggagcccgtgctgtcatccaacctggct
cagcgcagaggcatgaagagactcacgtccacgcggctgtag

DBGET integrated database retrieval system