KEGG   Homo sapiens (human): 6197Help
Entry
6197              CDS       T01001                                 

Gene name
RPS6KA3, CLS, HU-3, ISPK-1, MAPKAPK1B, MRX19, RSK, RSK2, S6K-alpha3, p90-RSK2, pp90RSK2
Definition
ribosomal protein S6 kinase, 90kDa, polypeptide 3 (EC:2.7.11.1)
Orthology
K04373  
p90 ribosomal S6 kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Oocyte meiosis
mTOR signaling pathway
Long-term potentiation
Neurotrophin signaling pathway
Progesterone-mediated oocyte maturation
Disease
H00480  
Non-syndromic X-linked mental retardation
H00574  
Coffin-Lowry syndrome (CLS)
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:hsa04150]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:hsa04914]
Organismal Systems; Nervous system; Long-term potentiation [PATH:hsa04720]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22.2-p22.1
AA seq 740 aa AA seqDB search
MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGH
EKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERD
ILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALA
LDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVV
NRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLR
MLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGRPEDTFYFDPE
FTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHSIVQQLHRNSIQFTD
GYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKRDPTEEIEILLRYGQHPNIITLK
DVYDDGKYVYVVTELMKGGELLDKILRQKFFSEREASAVLFTITKTVEYLHAQGVVHRDL
KPSNILYVDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACD
IWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSDTAKDLVSKML
HVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEP
VGRSTLAQRRGIKKITSTAL
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggcgcagctggcggacccgtggcagaagatggctgtggagagcccgtccgac
agcgctgagaatggacagcaaattatggatgaacctatgggagaggaggagattaaccca
caaactgaagaagtcagtatcaaagaaattgcaatcacacatcatgtaaaggaaggacat
gaaaaggcagatccttcccagtttgaacttttaaaagtattagggcagggatcatttgga
aaggttttcttagttaaaaaaatctcaggctctgatgctaggcagctttatgccatgaag
gtattgaagaaggccacactgaaagttcgagaccgagttcggacaaaaatggaacgtgat
atcttggtagaggttaatcatccttttattgtcaagttgcattatgcttttcaaactgaa
gggaagttgtatcttattttggattttctcaggggaggagatttgtttacacgcttatcc
aaagaggtgatgttcacagaagaagatgtcaaattctacttggctgaacttgcacttgct
ttagaccatctacatagcctgggaataatttatagagacttaaaaccagaaaatatactt
cttgatgaagaaggtcacatcaagttaacagatttcggcctaagtaaagagtctattgac
catgaaaagaaggcatattctttttgtggaactgtggagtatatggctccagaagtagtt
aatcgtcgaggtcatactcagagtgctgactggtggtcttttggtgtgttaatgtttgaa
atgcttactggtacactccctttccaaggaaaagatcgaaaagaaacaatgactatgatt
cttaaagccaaacttggaatgccacagtttttgagtcctgaagcgcagagtcttttacga
atgcttttcaagcgaaatcctgcaaacagattaggtgcaggaccagatggagttgaagaa
attaaaagacattcatttttctcaacgatagactggaataaactgtatagaagagaaatt
catccgccatttaaacctgcaacgggcaggcctgaagatacattctattttgatcctgag
tttactgcaaaaactcccaaagattcacctggcattccacctagtgctaatgcacatcag
ctttttcgggggtttagttttgttgctattacctcagatgatgaaagccaagctatgcag
acagttggtgtacattcaattgttcagcagttacacaggaacagtattcagtttactgat
ggatatgaagtaaaagaagatattggagttggctcctactctgtttgcaagagatgtata
cataaagctacaaacatggagtttgcagtgaagattattgataaaagcaagagagaccca
acagaagaaattgaaattcttcttcgttatggacagcatccaaacattatcactctaaag
gatgtatatgatgatggaaagtatgtgtatgtagtaacagaacttatgaaaggaggtgaa
ttgctggataaaattcttagacaaaaatttttctctgaacgagaggccagtgctgtcctg
ttcactataactaaaaccgttgaatatcttcacgcacaaggggtggttcatagagacttg
aaacctagcaacattctttatgtggatgaatctggtaatccggaatctattcgaatttgt
gattttggctttgcaaaacagctgagagcggaaaatggtcttctcatgactccttgttac
actgcaaattttgttgcaccagaggttttaaaaagacaaggctatgatgctgcttgtgat
atatggagtcttggtgtcctactctatacaatgcttaccggttacactccatttgcaaat
ggtcctgatgatacaccagaggaaatattggcacgaataggtagcggaaaattctcactc
agtggtggttactggaattctgtttcagacacagcaaaggacctggtgtcaaagatgctt
catgtagaccctcatcagagactgactgctgctcttgtgctcagacatccttggatcgtc
cactgggaccaactgccacaataccaactaaacagacaggatgcaccacatctagtaaag
ggtgccatggcagctacatattctgctttgaaccgtaatcagtcaccagttttggaacca
gtaggccgctctactcttgctcagcggagaggtattaaaaaaatcacctcaacagccctg
tga

DBGET integrated database retrieval system