KEGG   Homo sapiens (human): 6199Help
Entry
6199              CDS       T01001                                 

Gene name
RPS6KB2, KLS, P70-beta, P70-beta-1, P70-beta-2, S6K-beta2, S6K2, SRK, STK14B, p70(S6K)-beta, p70S6Kb
Definition
ribosomal protein S6 kinase, 70kDa, polypeptide 2 (EC:2.7.11.1)
Orthology
K04688  
p70 ribosomal S6 kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
TGF-beta signaling pathway
Fc gamma R-mediated phagocytosis
Insulin signaling pathway
Proteoglycans in cancer
Acute myeloid leukemia
Class
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:hsa04012]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:hsa04350]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:hsa04150]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hsa04666]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:hsa05221]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.2
AA seq 482 aa AA seqDB search
MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPE
RIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITL
ALGHLHSQGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIRGKLALPPYLTPDARDLV
KKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPPFRPCLQSEEDVSQFDT
RFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRA
PVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKKSKRGRGRP
GR
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtgtttgatttggatttggagacggaggaaggcagcgagggcgagggcgag
ccagagctcagccccgcggacgcatgtccccttgccgagttgagggcagctggcctagag
cctgtgggacactatgaagaggtggagctgactgagaccagcgtgaacgttggcccagag
cgcatcgggccccactgctttgagctgctgcgtgtgctgggcaaggggggctatggcaag
gtgttccaggtgcgaaaggtgcaaggcaccaacttgggcaaaatatatgccatgaaagtc
ctaaggaaggccaaaattgtgcgcaatgccaaggacacagcacacacacgggctgagcgg
aacattctagagtcagtgaagcacccctttattgtggaactggcctatgccttccagact
ggtggcaaactctacctcatccttgagtgcctcagtggtggcgagctcttcacgcatctg
gagcgagagggcatcttcctggaagatacggcctgcttctacctggctgagatcacgctg
gccctgggccatctccactcccagggcatcatctaccgggacctcaagcccgagaacatc
atgctcagcagccagggccacatcaaactgaccgactttggactctgcaaggagtctatc
catgagggcgccgtcactcacaccttctgcggcaccattgagtacatggcccctgagatt
ctggtgcgcagtggccacaaccgggctgtggactggtggagcctgggggccctgatgtac
gacatgctcactggatcgccgcccttcaccgcagagaaccggaagaaaaccatggataag
atcatcaggggcaagctggcactgcccccctacctcaccccagatgcccgggaccttgtc
aaaaagtttctgaaacggaatcccagccagcggattgggggtggcccaggggatgctgct
gatgtgcagagacatccctttttccggcacatgaattgggacgaccttctggcctggcgt
gtggacccccctttcaggccctgtctgcagtcagaggaggacgtgagccagtttgatacc
cgcttcacacggcagacgccggtggacagtcctgatgacacagccctcagcgagagtgcc
aaccaggccttcctgggcttcacatacgtggcgccgtctgtcctggacagcatcaaggag
ggcttctccttccagcccaagctgcgctcacccaggcgcctcaacagtagcccccgggcc
cccgtcagccccctcaagttctccccttttgaggggtttcggcccagccccagcctgccg
gagcccacggagctacctctacctccactcctgccaccgccgccgccctcgaccaccgcc
cctctccccatccgtcccccctcagggaccaagaagtccaagaggggccgtgggcgtcca
gggcgctag

DBGET integrated database retrieval system