KEGG   Homo sapiens (human): 622Help
Entry
622               CDS       T01001                                 

Gene name
BDH1, BDH, SDR9C1
Definition
3-hydroxybutyrate dehydrogenase, type 1 (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
hsa  Homo sapiens (human)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hsa00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:hsa00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q29
AA seq 343 aa AA seqDB search
MLATRLSRPLSRLPGKTLSACDRENGARRPLLLGSTSFIPIGRRTYASAAEPVGSKAVLV
TGCDSGFGFSLAKHLHSKGFLVFAGCLMKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEV
EKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMTKSFL
PLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGN
FIAATSLYSPESIQAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVID
AVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctggccacccgcctctccagacccctgtcacggctcccaggaaaaaccctaagtgcc
tgtgatagagaaaatggagcaagacgcccactattgcttggttctacttcctttatcccg
attggccgtcggacttatgccagtgcggcggagccggttggcagcaaagctgtcctggtc
acaggctgtgactctggatttgggttctcattggccaagcatctgcattcaaaaggcttc
cttgtgtttgctggctgcttgatgaaggacaaaggccatgatggggtcaaggagctggac
agcctaaacagtgaccgattgagaaccgtccagctcaatgtctgcagcagcgaagaggtg
gagaaagtggtggagattgtccgctcgagcctgaaggaccctgagaaaggcatgtggggc
ctcgttaacaatgccggcatctcaacgttcggggaggtggagttcaccagcctggagacc
tacaagcaggtggcagaagtgaacctttggggcacagtgcggatgacgaaatcctttctc
cccctcatccgaagggccaaaggccgcgtcgtcaatatcagcagcatgctgggccgcatg
gccaacccggcccgctccccgtactgcatcaccaagttcggggtagaggctttctcggac
tgcctgcgctatgagatgtaccccctgggcgtgaaggtcagcgtggtggagcccggcaac
ttcatcgctgccaccagcctttacagccctgagagcattcaggccatcgccaagaagatg
tgggaggagctgcctgaggtcgtgcgcaaggactacggcaagaagtactttgatgaaaag
atcgccaagatggagacctactgcagcagtggctccacagacacgtcccctgtcatcgat
gctgtcacacacgccctgaccgccaccaccccctacacccgctaccaccccatggactac
tactggtggctgcgaatgcagatcatgacccacttgcctggagccatctccgacatgatc
tacatccgctga

DBGET integrated database retrieval system