KEGG   Homo sapiens (human): 624Help
Entry
624               CDS       T01001                                 

Gene name
BDKRB2, B2R, BK-2, BK2, BKR2, BRB2
Definition
bradykinin receptor B2
Orthology
K03916  
bradykinin receptor B2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Complement and coagulation cascades
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Endocrine and other factor-regulated calcium reabsorption
Chagas disease (American trypanosomiasis)
Drug target
Icatibant: 
Other: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:hsa04961]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:hsa04750]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q32.1-q32.2
AA seq 391 aa AA seqDB search
MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
PPFLWVLFVLATLENIFVLSVFCLHKSSCTVAEIYLGNLAAADLILACGLPFWAITISNN
FDWLFGETLCRVVNAIISMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLV
IWGCTLLLSSPMLVFRTMKEYSDEGHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVI
TFCTMQIMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFIICWLPFQISTFLDTLHRLGI
LSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEP
IQMENSMGTLRTSISVERQIHKLQDWAGSRQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttctctccctggaagatatcaatgtttctgtctgttcgtgaggactccgtgcccacc
acggcctctttcagcgccgacatgctcaatgtcaccttgcaagggcccactcttaacggg
acctttgcccagagcaaatgcccccaagtggagtggctgggctggctcaacaccatccag
ccccccttcctctgggtgctgttcgtgctggccaccctagagaacatctttgtcctcagc
gtcttctgcctgcacaagagcagctgcacggtggcagagatctacctggggaacctggcc
gcagcagacctgatcctggcctgcgggctgcccttctgggccatcaccatctccaacaac
ttcgactggctctttggggagacgctctgccgcgtggtgaatgccattatctccatgaac
ctgtacagcagcatctgtttcctgatgctggtgagcatcgaccgctacctggccctggtg
aaaaccatgtccatgggccggatgcgcggcgtgcgctgggccaagctctacagcttggtg
atctgggggtgtacgctgctcctgagctcacccatgctggtgttccggaccatgaaggag
tacagcgatgagggccacaacgtcaccgcttgtgtcatcagctacccatccctcatctgg
gaagtgttcaccaacatgctcctgaatgtcgtgggcttcctgctgcccctgagtgtcatc
accttctgcacgatgcagatcatgcaggtgctgcggaacaacgagatgcagaagttcaag
gagatccagacagagaggagggccacggtgctagtcctggttgtgctgctgctattcatc
atctgctggctgcccttccagatcagcaccttcctggatacgctgcatcgcctcggcatc
ctctccagctgccaggacgagcgcatcatcgatgtaatcacacagatcgcctccttcatg
gcctacagcaacagctgcctcaacccactggtgtacgtgatcgtgggcaagcgcttccga
aagaagtcttgggaggtgtaccagggagtgtgccagaaagggggctgcaggtcagaaccc
attcagatggagaactccatgggcacactgcggacctccatctccgtggaacgccagatt
cacaaactgcaggactgggcagggagcagacagtga

DBGET integrated database retrieval system