KEGG   Homo sapiens (human): 624Help
Entry
624               CDS       T01001                                 

Gene name
BDKRB2, B2R, BK-2, BK2, BKR2, BRB2
Definition
bradykinin receptor B2
Orthology
K03916  
bradykinin receptor B2
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Complement and coagulation cascades
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Endocrine and other factor-regulated calcium reabsorption
Chagas disease (American trypanosomiasis)
Pathways in cancer
Drug target
Icatibant: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    624 (BDKRB2)
   04022 cGMP - PKG signaling pathway
    624 (BDKRB2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    624 (BDKRB2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    624 (BDKRB2)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    624 (BDKRB2)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    624 (BDKRB2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    624 (BDKRB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    624 (BDKRB2)
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    624 (BDKRB2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Cardiovascular peptide
   Bradykinin
    624 (BDKRB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q32.1-q32.2
AA seq 391 aa AA seqDB search
MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
PPFLWVLFVLATLENIFVLSVFCLHKSSCTVAEIYLGNLAAADLILACGLPFWAITISNN
FDWLFGETLCRVVNAIISMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLV
IWGCTLLLSSPMLVFRTMKEYSDEGHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVI
TFCTMQIMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFIICWLPFQISTFLDTLHRLGI
LSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEP
IQMENSMGTLRTSISVERQIHKLQDWAGSRQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttctctccctggaagatatcaatgtttctgtctgttcgtgaggactccgtgcccacc
acggcctctttcagcgccgacatgctcaatgtcaccttgcaagggcccactcttaacggg
acctttgcccagagcaaatgcccccaagtggagtggctgggctggctcaacaccatccag
ccccccttcctctgggtgctgttcgtgctggccaccctagagaacatctttgtcctcagc
gtcttctgcctgcacaagagcagctgcacggtggcagagatctacctggggaacctggcc
gcagcagacctgatcctggcctgcgggctgcccttctgggccatcaccatctccaacaac
ttcgactggctctttggggagacgctctgccgcgtggtgaatgccattatctccatgaac
ctgtacagcagcatctgtttcctgatgctggtgagcatcgaccgctacctggccctggtg
aaaaccatgtccatgggccggatgcgcggcgtgcgctgggccaagctctacagcttggtg
atctgggggtgtacgctgctcctgagctcacccatgctggtgttccggaccatgaaggag
tacagcgatgagggccacaacgtcaccgcttgtgtcatcagctacccatccctcatctgg
gaagtgttcaccaacatgctcctgaatgtcgtgggcttcctgctgcccctgagtgtcatc
accttctgcacgatgcagatcatgcaggtgctgcggaacaacgagatgcagaagttcaag
gagatccagacagagaggagggccacggtgctagtcctggttgtgctgctgctattcatc
atctgctggctgcccttccagatcagcaccttcctggatacgctgcatcgcctcggcatc
ctctccagctgccaggacgagcgcatcatcgatgtaatcacacagatcgcctccttcatg
gcctacagcaacagctgcctcaacccactggtgtacgtgatcgtgggcaagcgcttccga
aagaagtcttgggaggtgtaccagggagtgtgccagaaagggggctgcaggtcagaaccc
attcagatggagaactccatgggcacactgcggacctccatctccgtggaacgccagatt
cacaaactgcaggactgggcagggagcagacagtga

DBGET integrated database retrieval system