KEGG   Homo sapiens (human): 6240Help
Entry
6240              CDS       T01001                                 

Gene name
RRM1, R1, RIR1, RR1
Definition
(RefSeq) ribonucleotide reductase catalytic subunit M1 (EC:1.17.4.1)
  KO
K10807  
ribonucleoside-diphosphate reductase subunit M1 [EC:1.17.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Glutathione metabolism
Metabolic pathways
Drug target
Caracemide: 
Clofarabine: 
Gemcitabine (DG00688): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    6240 (RRM1)
   00240 Pyrimidine metabolism
    6240 (RRM1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    6240 (RRM1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     6240 (RRM1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    6240 (RRM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.5
AA seq 792 aa AA seqDB search
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLA
AETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKST
LDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHK
EDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCAL
ISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIY
LEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLD
EVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNL
GTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVVVRNLNKI
IDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGAL
EASCDLAKEQGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIA
PMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQII
ACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKL
TSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCS
LENRDECLMCGS
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtgatcaagcgagatggccgccaagaacgagtcatgtttgacaaaattacatct
cgaatccagaagctttgttatggactcaatatggattttgttgatcctgctcagatcacc
atgaaagtaatccaaggcttgtacagtggggtcaccacagtggaactagatactttggct
gctgaaacagctgcaaccttgactactaagcaccctgactatgctatcctggcagccagg
atcgctgtctctaacttgcacaaagaaacaaagaaagtgttcagtgatgtgatggaagac
ctctataactacataaatccacataatggcaaacactctcccatggtggccaagtcaaca
ttggatattgttctggccaataaagatcgcctgaattctgctattatctatgaccgagat
ttctcttacaattacttcggctttaagacgctagagcggtcttatttgttgaagatcaat
ggaaaagtggctgaaagaccacaacatatgttgatgagagtatctgttgggatccacaaa
gaagacattgatgcagcaattgaaacatataatcttctttctgagaggtggtttactcat
gcttcgcccactctcttcaatgctggtaccaaccgcccacaactttctagctgttttctt
ctgagtatgaaagatgacagcattgaaggcatttatgacactctaaagcaatgtgcattg
atttctaagtctgctggaggaattggtgttgctgtgagttgtattcgggctactggcagc
tacattgctgggactaatggcaattccaatggccttgtaccgatgctgagagtatataac
aacacagctcgatatgtggatcaaggtgggaacaagcgtcctggggcatttgctatttac
ctggagccttggcatttagacatctttgaattccttgatttaaagaagaacacaggaaag
gaagagcagcgtgccagagatcttttctttgctctttggattccggatctcttcatgaaa
cgagtggagactaatcaggactggtctttgatgtgtccaaatgagtgtcctggtctggat
gaggtttggggagaggaatttgagaaactatatgcaagttatgagaaacaaggtcgtgtc
cgcaaagttgtaaaagctcagcagctttggtatgccatcattgagtctcagacggaaaca
ggcaccccgtatatgctctacaaagattcctgtaatcgaaagagcaaccagcagaacctg
ggaaccatcaaatgcagcaacctgtgcacagaaatagtggagtacaccagcaaagatgag
gttgctgtttgtaatttggcttccctggccctgaatatgtatgtcacatcagaacacaca
tacgactttaagaagttggctgaagtcactaaagtcgttgtccgaaacttgaataaaatt
attgatataaactactatcctgtaccagaggcatgcctatcaaataaacgccatcgcccc
attggaattggggtacaaggtctggcagatgcttttatcctgatgagatacccttttgag
agtgcagaagcccagttactgaataagcagatctttgaaactatttattatggtgctctg
gaagccagctgtgaccttgccaaggagcagggcccatacgaaacctatgagggctctcca
gttagcaaaggaattcttcagtatgatatgtggaatgttactcctacagacctatgggac
tggaaggttctcaaggagaagattgcaaagtatggtataagaaacagtttacttattgcc
ccgatgcctacagcttccactgctcagatcctggggaataatgagtccattgaaccttac
accagcaacatctatactcgcagagtcttgtcaggagaatttcagattgtaaatcctcac
ttattgaaagatcttaccgagcggggcctatggcatgaagagatgaaaaaccagattatt
gcatgcaatggctctattcagagcataccagaaattcctgatgacctgaagcaactttat
aaaactgtgtgggaaatctctcagaaaactgttctcaagatggcagctgagagaggtgct
ttcattgatcaaagccaatctttgaacatccacattgctgagcctaactatggcaaactc
actagtatgcacttctacggctggaagcagggtttgaagactgggatgtattatttaagg
acaagaccagcggctaatccaatccagttcactctaaataaggagaagctaaaagataaa
gaaaaggtatcaaaagaggaagaagagaaggagaggaacacagcagccatggtgtgctct
ttggagaatagagatgaatgtctgatgtgtggatcctga

DBGET integrated database retrieval system