KEGG   Homo sapiens (human): 6241Help
Entry
6241              CDS       T01001                                 

Gene name
RRM2, R2, RR2, RR2M
Definition
(RefSeq) ribonucleotide reductase regulatory subunit M2
  KO
K10808  
ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Glutathione metabolism
Drug metabolism - other enzymes
Metabolic pathways
p53 signaling pathway
Drug target
Hydroxycarbamide: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    6241 (RRM2)
   00240 Pyrimidine metabolism
    6241 (RRM2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    6241 (RRM2)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    6241 (RRM2)
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    6241 (RRM2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     6241 (RRM2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    6241 (RRM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P31350(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
2p25.1
AA seq 389 aa AA seqDB search
MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKT
KAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLK
PEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLI
DTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSF
ASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIE
QEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTN
FFEKRVGEYQRMGVMSSPTENSFTLDADF
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgctctccctccgtgtcccgctcgcgcccatcacggacccgcagcagctgcagctctcg
ccgctgaaggggctcagcttggtcgacaaggagaacacgccgccggccctgagcgggacc
cgcgtcctggccagcaagaccgcgaggaggatcttccaggagcccacggagccgaaaact
aaagcagctgcccccggcgtggaggatgagccgctgctgagagaaaacccccgccgcttt
gtcatcttccccatcgagtaccatgatatctggcagatgtataagaaggcagaggcttcc
ttttggaccgccgaggaggtggacctctccaaggacattcagcactgggaatccctgaaa
cccgaggagagatattttatatcccatgttctggctttctttgcagcaagcgatggcata
gtaaatgaaaacttggtggagcgatttagccaagaagttcagattacagaagcccgctgt
ttctatggcttccaaattgccatggaaaacatacattctgaaatgtatagtcttcttatt
gacacttacataaaagatcccaaagaaagggaatttctcttcaatgccattgaaacgatg
ccttgtgtcaagaagaaggcagactgggccttgcgctggattggggacaaagaggctacc
tatggtgaacgtgttgtagcctttgctgcagtggaaggcattttcttttccggttctttt
gcgtcgatattctggctcaagaaacgaggactgatgcctggcctcacattttctaatgaa
cttattagcagagatgagggtttacactgtgattttgcttgcctgatgttcaaacacctg
gtacacaaaccatcggaggagagagtaagagaaataattatcaatgctgttcggatagaa
caggagttcctcactgaggccttgcctgtgaagctcattgggatgaattgcactctaatg
aagcaatacattgagtttgtggcagacagacttatgctggaactgggttttagcaaggtt
ttcagagtagagaacccatttgactttatggagaatatttcactggaaggaaagactaac
ttctttgagaagagagtaggcgagtatcagaggatgggagtgatgtcaagtccaacagag
aattcttttaccttggatgctgacttctaa

DBGET integrated database retrieval system