KEGG   Homo sapiens (human): 6241Help
Entry
6241              CDS       T01001                                 

Gene name
RRM2, R2, RR2, RR2M
Definition
ribonucleotide reductase M2 (EC:1.17.4.1)
Orthology
K10808  
ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Glutathione metabolism
Metabolic pathways
p53 signaling pathway
Drug target
Clofarabine: 
Hydroxycarbamide: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    6241 (RRM2)
   00240 Pyrimidine metabolism
    6241 (RRM2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    6241 (RRM2)
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    6241 (RRM2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     6241 (RRM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p25-p24
AA seq 389 aa AA seqDB search
MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKT
KAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLK
PEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLI
DTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSF
ASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIE
QEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTN
FFEKRVGEYQRMGVMSSPTENSFTLDADF
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgctctccctccgtgtcccgctcgcgcccatcacggacccgcagcagctgcagctctcg
ccgctgaaggggctcagcttggtcgacaaggagaacacgccgccggccctgagcgggacc
cgcgtcctggccagcaagaccgcgaggaggatcttccaggagcccacggagccgaaaact
aaagcagctgcccccggcgtggaggatgagccgctgctgagagaaaacccccgccgcttt
gtcatcttccccatcgagtaccatgatatctggcagatgtataagaaggcagaggcttcc
ttttggaccgccgaggaggtggacctctccaaggacattcagcactgggaatccctgaaa
cccgaggagagatattttatatcccatgttctggctttctttgcagcaagcgatggcata
gtaaatgaaaacttggtggagcgatttagccaagaagttcagattacagaagcccgctgt
ttctatggcttccaaattgccatggaaaacatacattctgaaatgtatagtcttcttatt
gacacttacataaaagatcccaaagaaagggaatttctcttcaatgccattgaaacgatg
ccttgtgtcaagaagaaggcagactgggccttgcgctggattggggacaaagaggctacc
tatggtgaacgtgttgtagcctttgctgcagtggaaggcattttcttttccggttctttt
gcgtcgatattctggctcaagaaacgaggactgatgcctggcctcacattttctaatgaa
cttattagcagagatgagggtttacactgtgattttgcttgcctgatgttcaaacacctg
gtacacaaaccatcggaggagagagtaagagaaataattatcaatgctgttcggatagaa
caggagttcctcactgaggccttgcctgtgaagctcattgggatgaattgcactctaatg
aagcaatacattgagtttgtggcagacagacttatgctggaactgggttttagcaaggtt
ttcagagtagagaacccatttgactttatggagaatatttcactggaaggaaagactaac
ttctttgagaagagagtaggcgagtatcagaggatgggagtgatgtcaagtccaacagag
aattcttttaccttggatgctgacttctaa

DBGET integrated database retrieval system