KEGG   Homo sapiens (human): 6247Help
Entry
6247              CDS       T01001                                 

Gene name
RS1, RS, XLRS1
Definition
retinoschisin 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp22.13
AA seq 224 aa AA seqDB search
MSRKIEGFLLLLLFGYEATLGLSSTEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCI
PECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSS
QWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNS
DRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcaagatagaaggctttttgttattacttctctttggctatgaagccacattg
ggattatcgtctaccgaggatgaaggcgaggacccctggtaccaaaaagcatgcaagtgc
gattgccaaggaggacccaatgctctgtggtctgcaggtgccacctccttggactgtata
ccagaatgcccatatcacaagcctctgggtttcgagtcaggggaggtcacaccggaccag
atcacctgctctaacccggagcagtatgtgggctggtattcttcgtggactgcaaacaag
gcccggctcaacagtcaaggctttgggtgtgcctggctctccaagttccaggacagtagc
cagtggttacagatagatctgaaggagatcaaagtgatttcagggatcctcacccagggg
cgctgtgacatcgatgagtggatgaccaagtacagcgtgcagtacaggaccgatgagcgc
ctgaactggatttactacaaggaccagactggaaacaaccgggtcttctatggcaactcg
gaccgcacctccacggttcagaacctgctgcggccccccatcatctcccgcttcatccgc
ctcatcccgctgggctggcacgtccgcattgccatccggatggagctgctggagtgcgtc
agcaagtgtgcctga

DBGET integrated database retrieval system