KEGG   Homo sapiens (human): 6257Help
Entry
6257              CDS       T01001                                 

Gene name
RXRB, DAUDI6, H-2RIIBP, NR2B2, RCoR-1
Definition
retinoid X receptor, beta
Orthology
K08525  
retinoid X receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Drug target
Alitretinoin: 
Bexarotene: 
Class
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cancers; Thyroid cancer [PATH:hsa05216]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:hsa05223]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 537 aa AA seqDB search
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQT
PEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPP
PPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVK
PPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS
CRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMP
VDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHF
SSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRS
LSRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCK
QKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggccgctcgcccgcccttcctccctcagcggcatgccgcagggcagtgtggg
ccggtgggggtgcgaaaagaaatgcattgtggggtcgcgtcccggtggcggcggcgacgg
ccctggctggatcccgcagcggcggcggcggcggcggtggcaggcggagaacaacaaacc
ccggagccggagccaggggaggctggacgggacgggatgggcgacagcgggcgggactcc
cgaagcccagacagctcctccccaaatccccttccccagggagtccctcccccttctcct
cctgggccacccctacccccttcaacagctccatcccttggaggctctggggccccaccc
ccacccccgatgccaccacccccactgggctctccctttccagtcatcagttcttccatg
gggtcccctggtctgccccctccagctcccccaggattctccgggcctgtcagcagcccc
cagattaactcaacagtgtcactccctgggggtgggtctggcccccctgaagatgtgaag
ccaccagtcttaggggtccggggcctgcactgtccaccccctccaggtggccctggggct
ggcaaacggctatgtgcaatctgcggggacagaagctcaggcaaacactacggggtttac
agctgtgagggttgcaagggcttcttcaaacgcaccatccgcaaagaccttacatactct
tgccgggacaacaaagactgcacagtggacaagcgccagcggaaccgctgtcagtactgc
cgctatcagaagtgcctggccactggcatgaagagggaggcggtacaggaggagcgtcag
cggggaaaggacaaggatggggatggggagggggctgggggagcccccgaggagatgcct
gtggacaggatcctggaggcagagcttgctgtggaacagaagagtgaccagggcgttgag
ggtcctgggggaaccgggggtagcggcagcagcccaaatgaccctgtgactaacatctgt
caggcagctgacaaacagctattcacgcttgttgagtgggcgaagaggatcccacacttt
tcctccttgcctctggatgatcaggtcatattgctgcgggcaggctggaatgaactcctc
attgcctccttctcacaccgatccattgatgttcgagatggcatcctccttgccacaggt
cttcacgtgcaccgcaactcagcccattcagcaggagtaggagccatctttgatcggtcc
ctctccagggtgctgacagagctagtgtccaaaatgcgtgacatgaggatggacaagaca
gagcttggctgcctgagggcaatcattctgtttaatccagatgccaagggcctctccaac
cctagtgaggtggaggtcctgcgggagaaagtgtatgcatcactggagacctactgcaaa
cagaagtaccctgagcagcagggacggtttgccaagctgctgctacgtcttcctgccctc
cggtccattggccttaagtgtctagagcatctgtttttcttcaagctcattggtgacacc
cccatcgacaccttcctcatggagatgcttgaggctccccatcaactggcctga

DBGET integrated database retrieval system