KEGG   Homo sapiens (human): 6261Help
Entry
6261              CDS       T01001                                 

Gene name
RYR1, CCO, MHS, MHS1, PPP1R137, RYDR, RYR, RYR-1, SKRR
Definition
(RefSeq) ryanodine receptor 1
  KO
K04961  
ryanodine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Apelin signaling pathway
Circadian entrainment
Long-term depression
Oxytocin signaling pathway
Disease
H00699  
Central core disease
H01310  
Multi-minicore disease (MmD)
Drug target
Aladorian (DG02040): 
Dantrolene (DG00778): 
Procaine (DG00298): 
Suramin sodium: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    6261 (RYR1)
   04020 Calcium signaling pathway
    6261 (RYR1)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    6261 (RYR1)
  Nervous system
   04730 Long-term depression
    6261 (RYR1)
  Environmental adaptation
   04713 Circadian entrainment
    6261 (RYR1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     6261 (RYR1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6261 (RYR1)
Ion channels [BR:hsa04040]
 Ryanodine and IP3 receptors
  Ryanodine receptor (RYR)
   6261 (RYR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P21817(Tclin)
UniProt: 
Position
19q13.2
AA seq 5038 aa AA seqDB search
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPD
LAICCFVLEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLSCL
TTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQ
RRLVYYEGGAVCTHARSLWRLEPLRISWSGSHLRWGQPLRVRHVTTGQYLALTEDQGLVV
VDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSF
SGKPRGSGPPAGTALPIEGVILSLQDLIIYFEPPSEDLQHEEKQSKLRSLRNRQSLFQEE
GMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLD
VLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGTTQYSK
WYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVV
SFSAGVKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLVG
PSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMM
SNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVGQGWSYSAVQDIPARRNPRL
VPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGR
PWQPGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFREIEIGDGFLPVCSLGPGQVGH
LNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAED
EARAAEPDPDYENLRRSAGGWSEAENGKEGTAKEGAPGGTPQAGGEAQPARAENEKDATT
EKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFV
SPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNV
IQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRV
AHALCSHVDQAQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTPE
TRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVK
QILKMIEPEVFTEEEEEEDEEEEGEEEDEEEKEEDEEETAQEKEDEEKEEEEAAEGEKEE
GLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGLL
IKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLLA
HCGIQLDGEEEEPEEETTLGSRLMSLLEKVRLVKKKEEKPEEERSAEESKPRSLQELVSH
MVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGES
KEIRFPKMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAASV
IDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRD
RRREHFGEEPPEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRSL
VPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVD
SMLHTVYRLSRGRSLTKAQRDVIEDCLMSLCRYIRPSMLQHLLRRLVFDVPILNEFAKMP
LKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAM
PCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAE
YTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWE
WTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAE
NYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRG
LKDMELDSSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFAK
ILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTD
APAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQART
QVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTKN
TYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMC
PDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPSALPAGA
PPPCTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLQSHFIP
TIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNR
AQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAK
AGDIQSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLITLAKTRY
ALKDTDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVS
AVLYYLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAA
WILTEDHSFEDRMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDEDY
LYMAYADIMAKSCHLEEGGENGEAEEEVEVSFEEKQMEKQRLLYQQARLHTRGAAEMVLQ
MISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSV
LDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQN
YLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQV
FNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQK
DMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQDYV
TDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGF
NVAVLLTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETN
RAQWEMPQVKESKRQFIFDVVNEGGEAEKMELFVSFCEDTIFEMQIAAQISEPEGEPETD
EDEGAGAAEAGAEGAEEGAAGLEGTAATAAAGATARVVAAAGRALRGLSYRSLRRRVRRL
RRLTAREAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTVTELL
AGMPDPTSDEVHGEQPAGPGGDADGEGASEGAGDAAEGAGDEEEAVHEAGPGGADGAVAV
TDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELE
PEKADAENGEKEEVPEPTPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLNYLSRNF
YTLRFLALFLAFAINFILLFYKVSDSPPGEDDMEGSAAGDVSGAGSGGSSGWGLGAGEEA
EGDEDENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELAR
KLEFDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIYGRERIAE
LLGMDLATLEITAHNERKPNPPPGLLTWLMSIDVKYQIWKFGVIFTDNSFLYLGWYMVMS
LLGHYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFF
RKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDIT
FFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHT
LEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS
NT seq 15117 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgcagaaggcgaagacgaggtccagttcctgcggacggacgatgaggtggtc
ctgcagtgcagcgctaccgtgctcaaggagcagctcaagctctgcctggccgccgagggc
ttcggcaaccgcctgtgcttcctggagcccactagcaacgcgcagaatgtgccccccgat
ctggccatctgttgcttcgtcctggagcagtccctgtctgtgcgagccctgcaggagatg
ctggctaacacggtggaggctggcgtggagtcatcccagggcgggggacacaggacgctc
ctgtatggccatgccatcctgctccggcatgcacacagccgcatgtatctgagctgcctc
accacctcccgctccatgactgacaagctggccttcgatgtgggactgcaggaggacgca
acaggagaggcttgctggtggaccatgcacccagcctccaagcagaggtctgaaggagaa
aaggtccgcgttggggatgacatcatccttgtcagtgtctcctccgagcgctacctgcac
ctgtcgaccgccagtggggagctccaggttgacgcttccttcatgcagacactatggaac
atgaaccccatctgctcccgctgcgaagagggcttcgtgacgggaggtcacgtcctccgc
ctctttcatggacatatggatgagtgtctgaccatttcccctgctgacagtgatgaccag
cgcagacttgtctactatgaggggggagctgtgtgcactcatgcccgctccctctggagg
ctggagccactgagaatcagctggagtgggagccacctgcgctggggccagccactccga
gtccggcatgtcactaccgggcagtacctagcgctcaccgaggaccagggcctggtggtg
gttgacgccagcaaggctcacaccaaggctacctccttctgcttccgcatctccaaggag
aagctggatgtggcccccaagcgggatgtggagggcatgggcccccctgagatcaagtac
ggggagtcactgtgcttcgtgcagcatgtggcctcaggactgtggctcacctatgctgct
ccagaccccaaggccctgcggctcggcgtgctcaagaagaaggccatgctgcaccaggag
ggccacatggacgacgcactgtcgctgacccgctgccagcaggaggagtcccaggccgcc
cgcatgatccacagcaccaatggcctatacaaccagttcatcaagagcctggacagcttc
agcgggaagccacggggctcggggccacccgctggcacggcgctgcccatcgagggcgtt
atcctgagcctgcaggacctcatcatctacttcgagcctccctccgaggacttgcagcac
gaggagaagcagagcaagctgcgaagcctgcgcaaccgccagagcctcttccaggaggag
gggatgctctccatggtcctgaattgcatagaccgcctaaatgtctacaccactgctgcc
cactttgctgagtttgcaggggaggaggcagccgagtcctggaaagagattgtgaatctt
ctctatgaactcctagcttctctaatccgtggcaatcgtagcaactgtgccctcttctcc
acaaacttggactggctggtcagcaagctggatcggctggaggcctcgtctggcatcctg
gaggtcctgtactgtgtcctcattgagagtccagaggttctgaacatcatccaggagaat
cacatcaagtccatcatctccctcctggacaagcatgggaggaaccacaaggtcctggac
gtgctatgctccctgtgtgtgtgtaatggtgtggctgtacgctccaaccaagatcttatt
actgagaacttgctgcctggccgtgagcttctgctgcagacaaacctcatcaactatgtc
accagcatccgccccaacatctttgtgggccgagcggaaggcaccacgcagtacagcaaa
tggtactttgaggtgatggtggacgaggtgactccatttctgacagctcaggccacccac
ttgcgggtgggctgggccctcaccgagggctacaccccctaccctggggccggcgagggc
tggggcggcaacggggtcggcgatgacctctattcctacggctttgatggactgcatctc
tggacaggacacgtggcacgcccagtgacttccccagggcagcacctcctggcccctgaa
gacgtgatcagctgctgcctggacctcagcgtgccgtccatctccttccgcatcaacggc
tgccccgtgcagggtgtctttgagtccttcaacctggacgggctcttcttccctgttgtc
agcttctcggctggtgtcaaggtgcggttcctccttggtggccgccatggtgaattcaag
ttcctgcccccacctggctatgctccatgccatgaggctgtgctccctcgagagcgactc
catcttgaacccatcaaggagtatcgacgggaggggccccgggggcctcacctggtgggc
cccagtcgctgcctctcacacaccgacttcgtgccctgccctgtggacactgtccagatt
gtcctgccgccccatctggagcgcattcgggagaagctggcggagaacatccacgagctc
tgggcgctaacccgcatcgagcagggctggacctacggcccggttcgggatgacaacaag
aggctgcacccgtgtcttgtggacttccacagccttccagagcctgagaggaactacaac
ctgcagatgtctggggagacgctcaagactctgctggctctgggctgccacgtgggcatg
gcggatgagaaggcggaggacaacctgaagaagacaaaactccccaagacgtatatgatg
agcaatgggtacaagccggctccgctggacctgagccacgtgcggctgacgccggcgcag
acgacactggtggaccgtctggcagaaaatgggcacaacgtgtgggcccgagaccgcgtg
ggccagggctggagctacagcgcagtgcaggacatcccagcgcgccgaaaccctcggctg
gtgccctaccgcctgctggatgaagccaccaagcgcagcaaccgggacagcctctgccag
gccgtgcgcaccctcctgggctacggctacaacatcgagcctcctgaccaggagcccagt
caggtggagaaccagtctcgttgtgaccgggtgcgcatcttccgggcagagaaatcctat
acagtgcagagcggccgctggtacttcgagtttgaagcagtcaccacaggcgagatgcgc
gtgggctgggcgaggcccgagctgaggcctgatgtagagctgggagctgacgagctggcc
tatgtcttcaatgggcaccgcggccagcgctggcacttgggcagtgaaccatttgggcgc
ccctggcagccgggcgatgtcgttggctgtatgatcgacctcacagagaacaccattatc
ttcaccctcaatggcgaggtcctcatgtctgactcaggctccgaaacagccttccgggag
attgagattggggacggcttcctgcccgtctgcagcttgggacctggccaggtgggtcat
ctgaacctgggccaggacgtgagctctctgaggttctttgccatctgtggcctccaggaa
ggcttcgagccatttgccatcaacatgcagcgcccagtcaccacctggttcagcaaaggc
ctgccccagtttgagccagtgccccttgaacaccctcactatgaggtatcccgagtggac
ggcactgtggacacgcccccctgcctgcgcctgacccaccgcacctggggctcccagaac
agcctggtggagatgcttttcctgcggctgagcctcccagtccagttccaccagcacttc
cgctgcactgcaggggccaccccgctggcacctcctggcctgcagccccccgccgaggac
gaggcccgggcggcggaacccgaccctgactacgaaaacctgcgccgctcagctgggggc
tggagcgaggcagagaacggcaaagaagggactgcgaaggagggcgcccccgggggcacc
ccgcaggcggggggagaggcgcagcccgccagggcggagaatgagaaggatgccaccacc
gagaagaacaagaagagaggcttcttattcaaggccaagaaggtcgccatgatgacccag
ccaccggccacccccacgctgccccgactccctcacgacgtggtgcctgcagacaaccgc
gatgaccccgagatcatcctcaacaccaccacgtactattactccgtgagggtctttgct
ggacaggagcccagctgcgtgtgggcgggctgggtcacccctgactaccatcagcacgac
atgagcttcgacctcagcaaggtccgggtcgtgacggtgaccatgggggatgaacaaggc
aacgtccacagcagcctcaagtgtagcaactgctacatggtgtggggcggagactttgtg
agtcccgggcagcagggccggatcagccacacggaccttgtcattgggtgcctggtggac
ttggccactggcttaatgacctttacagccaatggcaaagagagcaacacctttttccag
gtggaacccaacactaagctatttcctgccgtcttcgtcctgcccacccaccagaacgtc
atccagtttgagctggggaagcagaagaacatcatgccgttgtcagccgccatgttccaa
agcgagcgcaagaacccggccccgcagtgcccaccgcggctggagatgcagatgctgatg
ccagtgtcctggagccgcatgcccaaccacttcctgcaggtggagacgaggcgtgccggc
gagcggctgggctgggccgtgcagtgccaggagccgctgaccatgatggcgctgcacatc
cccgaggagaaccggtgcatggacatcctggagctgtcggagcgcctggacctgcagcgc
ttccactcgcacaccctgcgcctctaccgcgctgtgtgcgccctgggcaacaatcgcgtg
gcgcacgctctgtgcagccacgtagaccaagctcagctgctgcacgccctggaggacgcg
cacctgccaggcccactgcgcgcaggctactatgacctcctcatcagcatccacctcgaa
agtgcctgccgcagccgccgctccatgctctctgaatacatcgtgcccctcacgcctgag
acccgcgccatcacgctcttccctcctggaaggagcacagaaaatggtcacccccggcat
ggcctgccgggagttggagtcaccacttcgctgaggcccccgcatcatttctcgcccccc
tgtttcgtggccgctctgccagctgctggggcagcagaggccccggcccgcctcagccct
gccatcccgctggaggccctgcgggacaaggcactgaggatgctgggggaggcggtgcgc
gacggtgggcagcacgctcgcgaccccgtcgggggctccgtggagttccagtttgtgcct
gtgctcaagctcgtgtccaccctgctggtgatgggcatctttggcgatgaggatgtgaaa
cagatcttgaagatgattgagcctgaggtcttcactgaggaagaagaggaggaggacgag
gaggaagagggtgaagaggaagatgaggaggagaaggaggaggatgaggaggaaacagca
caggaaaaggaagatgaggaaaaagaggaagaggaggcagcagaaggggagaaagaagaa
ggcttggaggaagggctgctccagatgaagttgccagagtctgtgaagttacagatgtgc
cacctgctggagtatttctgtgaccaagagctgcagcaccgtgtggagtccctggcagcc
tttgcggagcgctatgtggacaagctccaggccaaccagcggagccgctatggcctcctc
ataaaagccttcagcatgaccgcagcagagactgcaagacgtacccgcgagttccgctcc
ccaccccaggaacagatcaatatgctattgcaattcaaagatggtacagatgaggaagac
tgtcctctccctgaagagattcgacaggatttgcttgactttcatcaagacctgctggca
cactgtggaattcagctagatggagaggaggaggaaccagaggaagagaccaccctgggc
agccgcctcatgagcctgttggagaaagtgcggctggtgaagaagaaggaagagaaacct
gaggaggagcggtcagcagaggagagcaaaccccggtccctgcaggagctggtgtcccac
atggtggtgcgctgggcccaagaggacttcgtgcagagccccgagctggtgcgggccatg
ttcagcctcctgcaccggcagtacgacgggctgggtgagctgctgcgtgccctgccgcgg
gcgtacaccatctcaccgtcctccgtggaagacaccatgagcctgctcgagtgcctcggc
cagatccgctcgctgctcatcgtgcagatgggcccccaggaggagaacctcatgatccag
agcatcgggaacatcatgaacaacaaagtcttctaccaacacccgaacctgatgagggcg
ctgggcatgcacgagacggtcatggaggtcatggtcaacgtcctcgggggcggcgagtcc
aaggagatccgcttccccaagatggtgacaagctgctgccgcttcctctgctatttctgc
cgaatcagccggcagaaccagcgctccatgtttgaccacctgagctacctgctggagaac
agtggcatcggcctgggcatgcagggctccacgcccctggacgtggctgctgcctccgtc
attgacaacaatgagctggccttggcattgcaggagcaggacctggaaaaggttgtgtcc
tacctggcaggctgtggcctccagagctgccccatgcttgtggccaaagggtacccagac
attggctggaacccctgtggtggagagcgctacctggacttcctgcgctttgctgtcttc
gtcaacggcgagagcgtggaggagaacgccaatgtggtggtgcggctgctcatccggaag
cctgagtgcttcggacccgccctgcggggtgagggtggctcagggctgctggctgccatc
gaagaggccatccgcatctccgaggaccctgcgagggatggcccaggcatccgcagggac
cggcggcgcgagcactttggtgaggaaccgcctgaagaaaaccgggtgcacctgggacac
gccatcatgtccttctatgccgccttgatcgacctgctcggacgctgtgcaccagagatg
catctaatccaagccggcaagggtgaggccctgcggatccgcgccatcctccgctccctt
gtgcccttggaggaccttgtgggcatcatcagcctcccactgcagattcccaccctgggc
aaagatggggctctggtgcagccaaagatgtcagcatccttcgtgccggaccacaaggcg
tccatggtgctcttcctggaccgtgtgtatggcatcgagaaccaggacttcttgctgcac
gtgctggacgtggggttcctgcccgacatgagggcagccgcctcgctggacacggccact
ttcagcaccaccgagatggcgctggcgctgaaccgctacctgtgcctggccgtgctgccg
ctcatcaccaagtgtgcgccgctctttgcgggcacagaacaccgcgccatcatggtggac
tctatgctgcataccgtgtaccgcctgtctcggggtcgttcgctcaccaaggcgcagcgt
gacgtcatcgaggactgcctcatgtcgctctgcaggtacatccgcccgtcgatgctgcag
cacctgttgcgccgcctggtgttcgacgtgcccatcctcaacgagttcgccaagatgcca
ctcaagctcctcaccaaccactatgagcgctgttggaagtactactgcctacccacgggc
tgggccaacttcggggtcacctcagaggaggagctgcacctcacacggaaactcttctgg
ggcatctttgactctctggcccataagaaatacgacccggagctgtaccgcatggccatg
ccttgtctgtgcgccattgccggggctctgccccccgactatgtggatgcctcatactca
tctaaggcagagaaaaaggccacagtggatgctgaaggcaactttgatccccggcctgtg
gagaccctcaatgtgatcatcccggagaagctggactccttcattaacaagtttgcggag
tacacacacgagaagtgggccttcgacaagatccagaacaactggtcctatggagagaac
atagacgaggagctgaagacccaccccatgctgaggccctacaagaccttttcagagaag
gacaaagagatttaccgctggcccatcaaggagtccctgaaggccatgattgcctgggaa
tggacgatagagaaggccagggagggtgaggaggagaagacggaaaagaaaaaaacgcgg
aagatatcacaaagtgcccagacctatgatcctcgagaaggctacaaccctcagcccccc
gaccttagtgctgttaccctgtcccgggagctgcaggccatggcagaacaactggcagaa
aattaccacaacacgtggggacggaagaagaagcaggagctggaagccaaaggcggtggg
acccaccccctgctggtcccctacgacacgctcacggccaaggagaaggcacgagatcga
gagaaggcccaggagctactgaaattcctgcagatgaatggctacgcggttacaagaggc
cttaaggacatggaactggactcgtcttccattgaaaagcggtttgcctttggcttcctg
cagcagctgctgcgctggatggacatttctcaggagttcattgcccacctggaggctgtg
gtcagcagtgggcgagtggaaaagtccccacatgaacaggagattaaattctttgccaag
atcctgctccctttgatcaaccagtacttcaccaaccactgcctctatttcttgtccact
ccggctaaagtgctgggcagcggtggccacgcctctaacaaggagaaggaaatgatcacc
agcctcttctgcaaacttgctgctctcgtccgccaccgagtctctctctttgggacagac
gccccagctgtggtcaactgtcttcacatcctggcccgctccctggatgccaggacagtg
atgaagtcaggccctgagatcgtgaaggctggcctccgctccttcttcgagagtgcctcg
gaggacatcgagaagatggtggagaacctgcggctgggcaaggtgtcgcaggcgcgcacc
caggtgaaaggcgtgggccagaacctcacctacaccactgtggcactgctgccggtcctc
accaccctcttccagcacatcgcccagcaccagttcggagatgacgtcatcctggacgac
gtccaggtctcttgctaccgaacgctgtgcagtatctactccctgggaaccaccaagaac
acttatgtggaaaagcttcggccagccctcggggagtgcctggcccgtctggcagcagcc
atgccggtggcgttcctggagccgcagctgaacgagtacaacgcctgctccgtgtacacc
accaagtctccgcgggagcgggccatcctggggctccccaacagtgtggaggagatgtgt
cccgacatcccggtgctggagcggctcatggcagacattggggggctggccgagtcaggt
gcccgctacacagagatgccgcatgtcatcgagatcacgctgcccatgctatgcagctac
ctgccccgatggtgggagcgcgggcccgaggcacccccttccgccctgcccgccggcgcc
cccccaccctgcacagctgtcacctctgaccacctcaactccctgctggggaatatcctg
agaatcatcgtcaacaacctgggcattgacgaggcctcctggatgaagcggctggctgtg
ttcgcacagcccattgtgagccgtgcacggccggagctcctgcagtcccacttcatccca
actatcgggcggctgcgcaagagggcagggaaggtggtgtccgaggaggagcagctgcgc
ctggaggccaaggcggaggcccaggagggcgagctgctggtgcgggacgagttctctgtg
ctctgccgggacctctacgccctgtatccgctgctcatccgctacgtggacaacaacagg
gcgcagtggctgacggagccgaatcccagcgcggaggagctgttcaggatggtgggcgag
atcttcatctactggtccaagtcccacaacttcaagcgcgaggagcagaactttgtggtc
cagaatgagatcaacaacatgtccttcctgactgctgacaacaaaagcaaaatggctaag
gcgggagatatacagtccggtggctcggaccaggaacgcaccaagaagaagcgccggggg
gaccggtactctgtgcagacgtcactgatcgtggccacactgaagaagatgctgcccatc
ggcctgaatatgtgtgcgcccaccgaccaagacctcatcacgctggccaagacccgttac
gccctgaaagacacagatgaggaggtccgggaatttctgcacaacaaccttcaccttcag
ggaaaggtcgaaggctccccgtctctgcgctggcagatggctctgtaccggggcgtcccg
ggtcgcgaggaggacgccgatgaccccgagaaaatcgtgcgcagagtccaggaagtgtca
gccgtgctctactacctggaccagaccgagcacccttacaagtctaagaaggccgtgtgg
cacaagcttttgtccaaacagcgccggcgggcagtcgtggcctgtttccgtatgacgccc
ctgtacaacctgcccacgcaccgggcatgtaacatgttcctggagagctacaaggctgca
tggatcctgactgaagaccacagttttgaggaccgcatgatagatgacctttcaaaagct
ggggagcaggaggaggaggaggaagaggtggaagagaagaagccagaccccctgcaccag
ttggtcctgcacttcagccgcactgccctgacggaaaagagcaaactggatgaggattac
ctgtacatggcctatgctgatatcatggcaaagagctgccacctggaggagggaggggag
aacggtgaagctgaagaggaggttgaggtctcctttgaggagaaacagatggagaagcag
aggctcttgtaccagcaagcacggctgcacacccggggggcggccgagatggtgctgcag
atgatcagtgcctgcaaaggagagacaggtgccatggtgtcctccaccctgaagctgggc
atctccatcctcaatggaggcaatgctgaggtccagcagaaaatgctggattatcttaag
gacaagaaggaagttggcttcttccagagtatccaggcactgatgcaaacatgcagcgtc
ctggatctcaatgcctttgagagacagaacaaggccgaggggctgggcatggtgaatgag
gatggcactgtcatcaatcgccagaacggagagaaggtcatggcggatgatgaattcaca
caagacctgttccgattcctacaattgctctgtgaggggcacaataatgatttccagaac
tacctacggacacagacagggaacacgaccactattaacatcatcatttgcactgtggac
tacctcctgcggctgcaggaatccatcagcgacttctactggtactactcgggcaaggat
gtcattgaagagcagggcaagaggaacttctccaaagccatgtcggtggctaagcaggtg
ttcaacagcctcactgagtacatccagggtccctgcaccgggaaccagcagagcctggcg
cacagtcgcctatgggacgcagtggtgggattcctgcacgtgttcgcccacatgatgatg
aagctcgctcaggactcaagccagatcgagctgctgaaggagctgctggatctgcagaag
gacatggtggtgatgttgctgtcgctactagaagggaacgtggtgaacggcatgatcgcc
cggcagatggtggacatgctcgtggaatcctcatccaatgtggagatgatcctcaagttc
ttcgacatgttcctgaaactcaaggacattgtgggctctgaagccttccaggactacgta
acggatccccgtggcctcatctccaagaaggacttccagaaggccatggacagccagaag
cagttcagcggtccagaaatccagttcctgctttcgtgctccgaagcggatgagaacgaa
atgatcaactgcgaagagttcgccaaccgcttccaggagccagcacgcgacatcggcttc
aacgtggcggtgctgctgaccaacctgtcggagcatgtgccgcatgaccctcgcctgcac
aacttcctggagctggccgagagcatccttgagtacttccgcccctacctgggccgcatc
gagatcatgggcgcgtcacgccgcatcgagcgcatctacttcgagatctcagagaccaac
cgcgcccagtgggagatgccccaggtgaaggagtccaagcgccagttcatcttcgacgtg
gtgaacgagggcggcgaggctgagaagatggagctcttcgtgagtttctgcgaggacacc
atcttcgagatgcagatcgccgcgcagatctcggagcccgagggcgagccggagaccgac
gaggacgagggcgcgggcgcggcggaggcgggcgcggaaggcgcggaggagggcgcggcg
gggctcgagggcacggcggccacggcggcggcgggggcgacggcgcgggttgtggcggcc
gcaggccgggccctgcgaggcctcagctaccgcagcctgcggcggcgcgtgcggcggctg
cggcggcttacggcccgcgaggcggccaccgcagtggcggcgctgctctgggcagcagtg
acgcgcgctggggccgctggcgcgggggcggcggcgggcgcgctgggcctgctctggggc
tcgctgttcggcggcggcctggtggagggcgccaagaaggtgacggtgaccgagctcctg
gcaggcatgcccgaccccaccagcgacgaggtgcacggcgagcagccggccgggccgggc
ggagacgcagacggcgagggtgccagcgagggcgctggagacgccgcggagggcgctgga
gacgaggaggaggcggtgcacgaggccgggccgggcggtgccgacggggcggtggccgtg
accgatgggggccccttccggcccgaaggggctggcggtctcggggacatgggggacacg
acgcctgcggaaccgcccacacccgagggctctcccatcctcaagaggaaattgggggtg
gatggagtggaggaggagctcccgccagagccagagcccgagccggaaccagagctggag
ccggagaaagccgatgccgagaatggggagaaggaagaagttcccgagcccacaccagag
ccccccaagaagcaagcacctccctcaccccctccaaagaaggaggaagctggaggcgaa
ttctggggagaactggaggtgcagagggtgaagttcctgaactacctgtcccggaacttt
tacaccctgcggttccttgccctcttcttggcatttgccatcaacttcatcttgctgttt
tataaggtctcagactctccaccaggggaggacgacatggaaggctcagctgctggggat
gtgtcaggtgcaggctctggtggcagctctggctggggcttgggggccggagaggaggca
gagggcgatgaggatgagaacatggtgtactacttcctggaggaaagcacaggctacatg
gaacccgccctgcggtgtctgagcctcctgcatacactggtggcctttctctgcatcatt
ggctataattgtctcaaggtgcccctggtaatctttaagcgggagaaggagctggcccgg
aagctggagtttgatggcctgtacatcacggagcagcctgaggacgatgacgtgaagggg
cagtgggaccgactggtgctcaacacgccgtctttccctagcaactactgggacaagttt
gtcaagcgcaaggtcctggacaaacatggggacatctacgggcgggagcggattgctgag
ctactgggcatggacctggccacactagagatcacagcccacaatgagcgcaagcccaac
ccgccgccagggctgctgacctggctcatgtccatcgatgtcaagtaccagatctggaag
ttcggggtcatcttcacagacaactccttcctgtacctgggctggtatatggtgatgtcc
ctcttgggacactacaacaacttcttctttgctgcccatctcctggacatcgccatgggg
gtcaagacgctgcgcaccatcctgtcctctgtcacccacaatgggaaacagctggtgatg
accgtgggccttctggcggtggtcgtctacctgtacaccgtggtggccttcaacttcttc
cgcaagttctacaacaagagcgaggatgaggatgaacctgacatgaagtgtgatgacatg
atgacgtgttacctgtttcacatgtacgtgggtgtccgggctggcggaggcattggggac
gagatcgaggaccccgcgggtgacgaatacgagctctacagggtggtcttcgacatcacc
ttcttcttcttcgtcatcgtcatcctgttggccatcatccagggtctgatcatcgacgct
tttggtgagctccgagaccaacaagagcaagtgaaggaggatatggagaccaagtgcttc
atctgtggaatcggcagtgactactttgatacgacaccgcatggcttcgagactcacacg
ctggaggagcacaacctggccaattacatgtttttcctgatgtatttgataaacaaggat
gagacagaacacacgggtcaggagtcttatgtctggaagatgtaccaagagagatgttgg
gatttcttcccagctggtgattgtttccgtaagcagtatgaggaccagcttagctga

DBGET integrated database retrieval system