KEGG   Homo sapiens (human): 6261Help
Entry
6261              CDS       T01001                                 

Gene name
RYR1, CCO, MHS, MHS1, RYDR, RYR, RYR-1, SKRR
Definition
ryanodine receptor 1 (skeletal)
Orthology
K04961  
ryanodine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Circadian entrainment
Long-term depression
Oxytocin signaling pathway
Disease
H00699  
Central core disease
H01310  
Multi-minicore disease (MmD)
Drug target
Procaine: 
Dantrolene: 
Suramin sodium: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    6261 (RYR1)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    6261 (RYR1)
  Nervous system
   04730 Long-term depression
    6261 (RYR1)
  Environmental adaptation
   04713 Circadian entrainment
    6261 (RYR1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     6261 (RYR1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6261 (RYR1)
Ion channels [BR:hsa04040]
 Ryanodine and IP3 receptors
  Ryanodine receptor (RYR)
   6261 (RYR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.1
AA seq 5038 aa AA seqDB search
MGDAEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPPD
LAICCFVLEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSRMYLSCL
TTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDIILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSRCEEGFVTGGHVLRLFHGHMDECLTISPADSDDQ
RRLVYYEGGAVCTHARSLWRLEPLRISWSGSHLRWGQPLRVRHVTTGQYLALTEDQGLVV
VDASKAHTKATSFCFRISKEKLDVAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAMLHQEGHMDDALSLTRCQQEESQAARMIHSTNGLYNQFIKSLDSF
SGKPRGSGPPAGTALPIEGVILSLQDLIIYFEPPSEDLQHEEKQSKLRSLRNRQSLFQEE
GMLSMVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRSNCALFS
TNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLD
VLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGTTQYSK
WYFEVMVDEVTPFLTAQATHLRVGWALTEGYTPYPGAGEGWGGNGVGDDLYSYGFDGLHL
WTGHVARPVTSPGQHLLAPEDVISCCLDLSVPSISFRINGCPVQGVFESFNLDGLFFPVV
SFSAGVKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLVG
PSRCLSHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMM
SNGYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVGQGWSYSAVQDIPARRNPRL
VPYRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSQVENQSRCDRVRIFRAEKSY
TVQSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGR
PWQPGDVVGCMIDLTENTIIFTLNGEVLMSDSGSETAFREIEIGDGFLPVCSLGPGQVGH
LNLGQDVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKGLPQFEPVPLEHPHYEVSRVD
GTVDTPPCLRLTHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLAPPGLQPPAED
EARAAEPDPDYENLRRSAGGWSEAENGKEGTAKEGAPGGTPQAGGEAQPARAENEKDATT
EKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFA
GQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFV
SPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNV
IQFELGKQKNIMPLSAAMFQSERKNPAPQCPPRLEMQMLMPVSWSRMPNHFLQVETRRAG
ERLGWAVQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYRAVCALGNNRV
AHALCSHVDQAQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTPE
TRAITLFPPGRSTENGHPRHGLPGVGVTTSLRPPHHFSPPCFVAALPAAGAAEAPARLSP
AIPLEALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVK
QILKMIEPEVFTEEEEEEDEEEEGEEEDEEEKEEDEEETAQEKEDEEKEEEEAAEGEKEE
GLEEGLLQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRSRYGLL
IKAFSMTAAETARRTREFRSPPQEQINMLLQFKDGTDEEDCPLPEEIRQDLLDFHQDLLA
HCGIQLDGEEEEPEEETTLGSRLMSLLEKVRLVKKKEEKPEEERSAEESKPRSLQELVSH
MVVRWAQEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLG
QIRSLLIVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGES
KEIRFPKMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAASV
IDNNELALALQEQDLEKVVSYLAGCGLQSCPMLVAKGYPDIGWNPCGGERYLDFLRFAVF
VNGESVEENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGIRRD
RRREHFGEEPPEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRSL
VPLEDLVGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLH
VLDVGFLPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVD
SMLHTVYRLSRGRSLTKAQRDVIEDCLMSLCRYIRPSMLQHLLRRLVFDVPILNEFAKMP
LKLLTNHYERCWKYYCLPTGWANFGVTSEEELHLTRKLFWGIFDSLAHKKYDPELYRMAM
PCLCAIAGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAE
YTHEKWAFDKIQNNWSYGENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWE
WTIEKAREGEEEKTEKKKTRKISQSAQTYDPREGYNPQPPDLSAVTLSRELQAMAEQLAE
NYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRG
LKDMELDSSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFAK
ILLPLINQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTD
APAVVNCLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQART
QVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTKN
TYVEKLRPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMC
PDIPVLERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPSALPAGA
PPPCTAVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLQSHFIP
TIGRLRKRAGKVVSEEEQLRLEAKAEAQEGELLVRDEFSVLCRDLYALYPLLIRYVDNNR
AQWLTEPNPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAK
AGDIQSGGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLITLAKTRY
ALKDTDEEVREFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVS
AVLYYLDQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKAA
WILTEDHSFEDRMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDEDY
LYMAYADIMAKSCHLEEGGENGEAEEEVEVSFEEKQMEKQRLLYQQARLHTRGAAEMVLQ
MISACKGETGAMVSSTLKLGISILNGGNAEVQQKMLDYLKDKKEVGFFQSIQALMQTCSV
LDLNAFERQNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQN
YLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQV
FNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQK
DMVVMLLSLLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQDYV
TDPRGLISKKDFQKAMDSQKQFSGPEIQFLLSCSEADENEMINCEEFANRFQEPARDIGF
NVAVLLTNLSEHVPHDPRLHNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETN
RAQWEMPQVKESKRQFIFDVVNEGGEAEKMELFVSFCEDTIFEMQIAAQISEPEGEPETD
EDEGAGAAEAGAEGAEEGAAGLEGTAATAAAGATARVVAAAGRALRGLSYRSLRRRVRRL
RRLTAREAATAVAALLWAAVTRAGAAGAGAAAGALGLLWGSLFGGGLVEGAKKVTVTELL
AGMPDPTSDEVHGEQPAGPGGDADGEGASEGAGDAAEGAGDEEEAVHEAGPGGADGAVAV
TDGGPFRPEGAGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGVEEELPPEPEPEPEPELE
PEKADAENGEKEEVPEPTPEPPKKQAPPSPPPKKEEAGGEFWGELEVQRVKFLNYLSRNF
YTLRFLALFLAFAINFILLFYKVSDSPPGEDDMEGSAAGDVSGAGSGGSSGWGLGAGEEA
EGDEDENMVYYFLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELAR
KLEFDGLYITEQPEDDDVKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIYGRERIAE
LLGMDLATLEITAHNERKPNPPPGLLTWLMSIDVKYQIWKFGVIFTDNSFLYLGWYMVMS
LLGHYNNFFFAAHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFF
RKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDIT
FFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHT
LEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS
NT seq 15117 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgcagaaggcgaagacgaggtccagttcctgcggacggacgatgaggtggtc
ctgcagtgcagcgctaccgtgctcaaggagcagctcaagctctgcctggccgccgagggc
ttcggcaaccgcctgtgcttcctggagcccactagcaacgcgcagaatgtgccccccgat
ctggccatctgttgcttcgtcctggagcagtccctgtctgtgcgagccctgcaggagatg
ctggctaacacggtggaggctggcgtggagtcatcccagggcgggggacacaggacgctc
ctgtatggccatgccatcctgctccggcatgcacacagccgcatgtatctgagctgcctc
accacctcccgctccatgactgacaagctggccttcgatgtgggactgcaggaggacgca
acaggagaggcttgctggtggaccatgcacccagcctccaagcagaggtctgaaggagaa
aaggtccgcgttggggatgacatcatccttgtcagtgtctcctccgagcgctacctgcac
ctgtcgaccgccagtggggagctccaggttgacgcttccttcatgcagacactatggaac
atgaaccccatctgctcccgctgcgaagagggcttcgtgacgggaggtcacgtcctccgc
ctctttcatggacatatggatgagtgtctgaccatttcccctgctgacagtgatgaccag
cgcagacttgtctactatgaggggggagctgtgtgcactcatgcccgctccctctggagg
ctggagccactgagaatcagctggagtgggagccacctgcgctggggccagccactccga
gtccggcatgtcactaccgggcagtacctagcgctcaccgaggaccagggcctggtggtg
gttgacgccagcaaggctcacaccaaggctacctccttctgcttccgcatctccaaggag
aagctggatgtggcccccaagcgggatgtggagggcatgggcccccctgagatcaagtac
ggggagtcactgtgcttcgtgcagcatgtggcctcaggactgtggctcacctatgctgct
ccagaccccaaggccctgcggctcggcgtgctcaagaagaaggccatgctgcaccaggag
ggccacatggacgacgcactgtcgctgacccgctgccagcaggaggagtcccaggccgcc
cgcatgatccacagcaccaatggcctatacaaccagttcatcaagagcctggacagcttc
agcgggaagccacggggctcggggccacccgctggcacggcgctgcccatcgagggcgtt
atcctgagcctgcaggacctcatcatctacttcgagcctccctccgaggacttgcagcac
gaggagaagcagagcaagctgcgaagcctgcgcaaccgccagagcctcttccaggaggag
gggatgctctccatggtcctgaattgcatagaccgcctaaatgtctacaccactgctgcc
cactttgctgagtttgcaggggaggaggcagccgagtcctggaaagagattgtgaatctt
ctctatgaactcctagcttctctaatccgtggcaatcgtagcaactgtgccctcttctcc
acaaacttggactggctggtcagcaagctggatcggctggaggcctcgtctggcatcctg
gaggtcctgtactgtgtcctcattgagagtccagaggttctgaacatcatccaggagaat
cacatcaagtccatcatctccctcctggacaagcatgggaggaaccacaaggtcctggac
gtgctatgctccctgtgtgtgtgtaatggtgtggctgtacgctccaaccaagatcttatt
actgagaacttgctgcctggccgtgagcttctgctgcagacaaacctcatcaactatgtc
accagcatccgccccaacatctttgtgggccgagcggaaggcaccacgcagtacagcaaa
tggtactttgaggtgatggtggacgaggtgactccatttctgacagctcaggccacccac
ttgcgggtgggctgggccctcaccgagggctacaccccctaccctggggccggcgagggc
tggggcggcaacggggtcggcgatgacctctattcctacggctttgatggactgcatctc
tggacaggacacgtggcacgcccagtgacttccccagggcagcacctcctggcccctgaa
gacgtgatcagctgctgcctggacctcagcgtgccgtccatctccttccgcatcaacggc
tgccccgtgcagggtgtctttgagtccttcaacctggacgggctcttcttccctgttgtc
agcttctcggctggtgtcaaggtgcggttcctccttggtggccgccatggtgaattcaag
ttcctgcccccacctggctatgctccatgccatgaggctgtgctccctcgagagcgactc
catcttgaacccatcaaggagtatcgacgggaggggccccgggggcctcacctggtgggc
cccagtcgctgcctctcacacaccgacttcgtgccctgccctgtggacactgtccagatt
gtcctgccgccccatctggagcgcattcgggagaagctggcggagaacatccacgagctc
tgggcgctaacccgcatcgagcagggctggacctacggcccggttcgggatgacaacaag
aggctgcacccgtgtcttgtggacttccacagccttccagagcctgagaggaactacaac
ctgcagatgtctggggagacgctcaagactctgctggctctgggctgccacgtgggcatg
gcggatgagaaggcggaggacaacctgaagaagacaaaactccccaagacgtatatgatg
agcaatgggtacaagccggctccgctggacctgagccacgtgcggctgacgccggcgcag
acgacactggtggaccgtctggcagaaaatgggcacaacgtgtgggcccgagaccgcgtg
ggccagggctggagctacagcgcagtgcaggacatcccagcgcgccgaaaccctcggctg
gtgccctaccgcctgctggatgaagccaccaagcgcagcaaccgggacagcctctgccag
gccgtgcgcaccctcctgggctacggctacaacatcgagcctcctgaccaggagcccagt
caggtggagaaccagtctcgttgtgaccgggtgcgcatcttccgggcagagaaatcctat
acagtgcagagcggccgctggtacttcgagtttgaagcagtcaccacaggcgagatgcgc
gtgggctgggcgaggcccgagctgaggcctgatgtagagctgggagctgacgagctggcc
tatgtcttcaatgggcaccgcggccagcgctggcacttgggcagtgaaccatttgggcgc
ccctggcagccgggcgatgtcgttggctgtatgatcgacctcacagagaacaccattatc
ttcaccctcaatggcgaggtcctcatgtctgactcaggctccgaaacagccttccgggag
attgagattggggacggcttcctgcccgtctgcagcttgggacctggccaggtgggtcat
ctgaacctgggccaggacgtgagctctctgaggttctttgccatctgtggcctccaggaa
ggcttcgagccatttgccatcaacatgcagcgcccagtcaccacctggttcagcaaaggc
ctgccccagtttgagccagtgccccttgaacaccctcactatgaggtatcccgagtggac
ggcactgtggacacgcccccctgcctgcgcctgacccaccgcacctggggctcccagaac
agcctggtggagatgcttttcctgcggctgagcctcccagtccagttccaccagcacttc
cgctgcactgcaggggccaccccgctggcacctcctggcctgcagccccccgccgaggac
gaggcccgggcggcggaacccgaccctgactacgaaaacctgcgccgctcagctgggggc
tggagcgaggcagagaacggcaaagaagggactgcgaaggagggcgcccccgggggcacc
ccgcaggcggggggagaggcgcagcccgccagggcggagaatgagaaggatgccaccacc
gagaagaacaagaagagaggcttcttattcaaggccaagaaggtcgccatgatgacccag
ccaccggccacccccacgctgccccgactccctcacgacgtggtgcctgcagacaaccgc
gatgaccccgagatcatcctcaacaccaccacgtactattactccgtgagggtctttgct
ggacaggagcccagctgcgtgtgggcgggctgggtcacccctgactaccatcagcacgac
atgagcttcgacctcagcaaggtccgggtcgtgacggtgaccatgggggatgaacaaggc
aacgtccacagcagcctcaagtgtagcaactgctacatggtgtggggcggagactttgtg
agtcccgggcagcagggccggatcagccacacggaccttgtcattgggtgcctggtggac
ttggccactggcttaatgacctttacagccaatggcaaagagagcaacacctttttccag
gtggaacccaacactaagctatttcctgccgtcttcgtcctgcccacccaccagaacgtc
atccagtttgagctggggaagcagaagaacatcatgccgttgtcagccgccatgttccaa
agcgagcgcaagaacccggccccgcagtgcccaccgcggctggagatgcagatgctgatg
ccagtgtcctggagccgcatgcccaaccacttcctgcaggtggagacgaggcgtgccggc
gagcggctgggctgggccgtgcagtgccaggagccgctgaccatgatggcgctgcacatc
cccgaggagaaccggtgcatggacatcctggagctgtcggagcgcctggacctgcagcgc
ttccactcgcacaccctgcgcctctaccgcgctgtgtgcgccctgggcaacaatcgcgtg
gcgcacgctctgtgcagccacgtagaccaagctcagctgctgcacgccctggaggacgcg
cacctgccaggcccactgcgcgcaggctactatgacctcctcatcagcatccacctcgaa
agtgcctgccgcagccgccgctccatgctctctgaatacatcgtgcccctcacgcctgag
acccgcgccatcacgctcttccctcctggaaggagcacagaaaatggtcacccccggcat
ggcctgccgggagttggagtcaccacttcgctgaggcccccgcatcatttctcgcccccc
tgtttcgtggccgctctgccagctgctggggcagcagaggccccggcccgcctcagccct
gccatcccgctggaggccctgcgggacaaggcactgaggatgctgggggaggcggtgcgc
gacggtgggcagcacgctcgcgaccccgtcgggggctccgtggagttccagtttgtgcct
gtgctcaagctcgtgtccaccctgctggtgatgggcatctttggcgatgaggatgtgaaa
cagatcttgaagatgattgagcctgaggtcttcactgaggaagaagaggaggaggacgag
gaggaagagggtgaagaggaagatgaggaggagaaggaggaggatgaggaggaaacagca
caggaaaaggaagatgaggaaaaagaggaagaggaggcagcagaaggggagaaagaagaa
ggcttggaggaagggctgctccagatgaagttgccagagtctgtgaagttacagatgtgc
cacctgctggagtatttctgtgaccaagagctgcagcaccgtgtggagtccctggcagcc
tttgcggagcgctatgtggacaagctccaggccaaccagcggagccgctatggcctcctc
ataaaagccttcagcatgaccgcagcagagactgcaagacgtacccgcgagttccgctcc
ccaccccaggaacagatcaatatgctattgcaattcaaagatggtacagatgaggaagac
tgtcctctccctgaagagattcgacaggatttgcttgactttcatcaagacctgctggca
cactgtggaattcagctagatggagaggaggaggaaccagaggaagagaccaccctgggc
agccgcctcatgagcctgttggagaaagtgcggctggtgaagaagaaggaagagaaacct
gaggaggagcggtcagcagaggagagcaaaccccggtccctgcaggagctggtgtcccac
atggtggtgcgctgggcccaagaggacttcgtgcagagccccgagctggtgcgggccatg
ttcagcctcctgcaccggcagtacgacgggctgggtgagctgctgcgtgccctgccgcgg
gcgtacaccatctcaccgtcctccgtggaagacaccatgagcctgctcgagtgcctcggc
cagatccgctcgctgctcatcgtgcagatgggcccccaggaggagaacctcatgatccag
agcatcgggaacatcatgaacaacaaagtcttctaccaacacccgaacctgatgagggcg
ctgggcatgcacgagacggtcatggaggtcatggtcaacgtcctcgggggcggcgagtcc
aaggagatccgcttccccaagatggtgacaagctgctgccgcttcctctgctatttctgc
cgaatcagccggcagaaccagcgctccatgtttgaccacctgagctacctgctggagaac
agtggcatcggcctgggcatgcagggctccacgcccctggacgtggctgctgcctccgtc
attgacaacaatgagctggccttggcattgcaggagcaggacctggaaaaggttgtgtcc
tacctggcaggctgtggcctccagagctgccccatgcttgtggccaaagggtacccagac
attggctggaacccctgtggtggagagcgctacctggacttcctgcgctttgctgtcttc
gtcaacggcgagagcgtggaggagaacgccaatgtggtggtgcggctgctcatccggaag
cctgagtgcttcggacccgccctgcggggtgagggtggctcagggctgctggctgccatc
gaagaggccatccgcatctccgaggaccctgcgagggatggcccaggcatccgcagggac
cggcggcgcgagcactttggtgaggaaccgcctgaagaaaaccgggtgcacctgggacac
gccatcatgtccttctatgccgccttgatcgacctgctcggacgctgtgcaccagagatg
catctaatccaagccggcaagggtgaggccctgcggatccgcgccatcctccgctccctt
gtgcccttggaggaccttgtgggcatcatcagcctcccactgcagattcccaccctgggc
aaagatggggctctggtgcagccaaagatgtcagcatccttcgtgccggaccacaaggcg
tccatggtgctcttcctggaccgtgtgtatggcatcgagaaccaggacttcttgctgcac
gtgctggacgtggggttcctgcccgacatgagggcagccgcctcgctggacacggccact
ttcagcaccaccgagatggcgctggcgctgaaccgctacctgtgcctggccgtgctgccg
ctcatcaccaagtgtgcgccgctctttgcgggcacagaacaccgcgccatcatggtggac
tctatgctgcataccgtgtaccgcctgtctcggggtcgttcgctcaccaaggcgcagcgt
gacgtcatcgaggactgcctcatgtcgctctgcaggtacatccgcccgtcgatgctgcag
cacctgttgcgccgcctggtgttcgacgtgcccatcctcaacgagttcgccaagatgcca
ctcaagctcctcaccaaccactatgagcgctgttggaagtactactgcctacccacgggc
tgggccaacttcggggtcacctcagaggaggagctgcacctcacacggaaactcttctgg
ggcatctttgactctctggcccataagaaatacgacccggagctgtaccgcatggccatg
ccttgtctgtgcgccattgccggggctctgccccccgactatgtggatgcctcatactca
tctaaggcagagaaaaaggccacagtggatgctgaaggcaactttgatccccggcctgtg
gagaccctcaatgtgatcatcccggagaagctggactccttcattaacaagtttgcggag
tacacacacgagaagtgggccttcgacaagatccagaacaactggtcctatggagagaac
atagacgaggagctgaagacccaccccatgctgaggccctacaagaccttttcagagaag
gacaaagagatttaccgctggcccatcaaggagtccctgaaggccatgattgcctgggaa
tggacgatagagaaggccagggagggtgaggaggagaagacggaaaagaaaaaaacgcgg
aagatatcacaaagtgcccagacctatgatcctcgagaaggctacaaccctcagcccccc
gaccttagtgctgttaccctgtcccgggagctgcaggccatggcagaacaactggcagaa
aattaccacaacacgtggggacggaagaagaagcaggagctggaagccaaaggcggtggg
acccaccccctgctggtcccctacgacacgctcacggccaaggagaaggcacgagatcga
gagaaggcccaggagctactgaaattcctgcagatgaatggctacgcggttacaagaggc
cttaaggacatggaactggactcgtcttccattgaaaagcggtttgcctttggcttcctg
cagcagctgctgcgctggatggacatttctcaggagttcattgcccacctggaggctgtg
gtcagcagtgggcgagtggaaaagtccccacatgaacaggagattaaattctttgccaag
atcctgctccctttgatcaaccagtacttcaccaaccactgcctctatttcttgtccact
ccggctaaagtgctgggcagcggtggccacgcctctaacaaggagaaggaaatgatcacc
agcctcttctgcaaacttgctgctctcgtccgccaccgagtctctctctttgggacagac
gccccagctgtggtcaactgtcttcacatcctggcccgctccctggatgccaggacagtg
atgaagtcaggccctgagatcgtgaaggctggcctccgctccttcttcgagagtgcctcg
gaggacatcgagaagatggtggagaacctgcggctgggcaaggtgtcgcaggcgcgcacc
caggtgaaaggcgtgggccagaacctcacctacaccactgtggcactgctgccggtcctc
accaccctcttccagcacatcgcccagcaccagttcggagatgacgtcatcctggacgac
gtccaggtctcttgctaccgaacgctgtgcagtatctactccctgggaaccaccaagaac
acttatgtggaaaagcttcggccagccctcggggagtgcctggcccgtctggcagcagcc
atgccggtggcgttcctggagccgcagctgaacgagtacaacgcctgctccgtgtacacc
accaagtctccgcgggagcgggccatcctggggctccccaacagtgtggaggagatgtgt
cccgacatcccggtgctggagcggctcatggcagacattggggggctggccgagtcaggt
gcccgctacacagagatgccgcatgtcatcgagatcacgctgcccatgctatgcagctac
ctgccccgatggtgggagcgcgggcccgaggcacccccttccgccctgcccgccggcgcc
cccccaccctgcacagctgtcacctctgaccacctcaactccctgctggggaatatcctg
agaatcatcgtcaacaacctgggcattgacgaggcctcctggatgaagcggctggctgtg
ttcgcacagcccattgtgagccgtgcacggccggagctcctgcagtcccacttcatccca
actatcgggcggctgcgcaagagggcagggaaggtggtgtccgaggaggagcagctgcgc
ctggaggccaaggcggaggcccaggagggcgagctgctggtgcgggacgagttctctgtg
ctctgccgggacctctacgccctgtatccgctgctcatccgctacgtggacaacaacagg
gcgcagtggctgacggagccgaatcccagcgcggaggagctgttcaggatggtgggcgag
atcttcatctactggtccaagtcccacaacttcaagcgcgaggagcagaactttgtggtc
cagaatgagatcaacaacatgtccttcctgactgctgacaacaaaagcaaaatggctaag
gcgggagatatacagtccggtggctcggaccaggaacgcaccaagaagaagcgccggggg
gaccggtactctgtgcagacgtcactgatcgtggccacactgaagaagatgctgcccatc
ggcctgaatatgtgtgcgcccaccgaccaagacctcatcacgctggccaagacccgttac
gccctgaaagacacagatgaggaggtccgggaatttctgcacaacaaccttcaccttcag
ggaaaggtcgaaggctccccgtctctgcgctggcagatggctctgtaccggggcgtcccg
ggtcgcgaggaggacgccgatgaccccgagaaaatcgtgcgcagagtccaggaagtgtca
gccgtgctctactacctggaccagaccgagcacccttacaagtctaagaaggccgtgtgg
cacaagcttttgtccaaacagcgccggcgggcagtcgtggcctgtttccgtatgacgccc
ctgtacaacctgcccacgcaccgggcatgtaacatgttcctggagagctacaaggctgca
tggatcctgactgaagaccacagttttgaggaccgcatgatagatgacctttcaaaagct
ggggagcaggaggaggaggaggaagaggtggaagagaagaagccagaccccctgcaccag
ttggtcctgcacttcagccgcactgccctgacggaaaagagcaaactggatgaggattac
ctgtacatggcctatgctgatatcatggcaaagagctgccacctggaggagggaggggag
aacggtgaagctgaagaggaggttgaggtctcctttgaggagaaacagatggagaagcag
aggctcttgtaccagcaagcacggctgcacacccggggggcggccgagatggtgctgcag
atgatcagtgcctgcaaaggagagacaggtgccatggtgtcctccaccctgaagctgggc
atctccatcctcaatggaggcaatgctgaggtccagcagaaaatgctggattatcttaag
gacaagaaggaagttggcttcttccagagtatccaggcactgatgcaaacatgcagcgtc
ctggatctcaatgcctttgagagacagaacaaggccgaggggctgggcatggtgaatgag
gatggcactgtcatcaatcgccagaacggagagaaggtcatggcggatgatgaattcaca
caagacctgttccgattcctacaattgctctgtgaggggcacaataatgatttccagaac
tacctacggacacagacagggaacacgaccactattaacatcatcatttgcactgtggac
tacctcctgcggctgcaggaatccatcagcgacttctactggtactactcgggcaaggat
gtcattgaagagcagggcaagaggaacttctccaaagccatgtcggtggctaagcaggtg
ttcaacagcctcactgagtacatccagggtccctgcaccgggaaccagcagagcctggcg
cacagtcgcctatgggacgcagtggtgggattcctgcacgtgttcgcccacatgatgatg
aagctcgctcaggactcaagccagatcgagctgctgaaggagctgctggatctgcagaag
gacatggtggtgatgttgctgtcgctactagaagggaacgtggtgaacggcatgatcgcc
cggcagatggtggacatgctcgtggaatcctcatccaatgtggagatgatcctcaagttc
ttcgacatgttcctgaaactcaaggacattgtgggctctgaagccttccaggactacgta
acggatccccgtggcctcatctccaagaaggacttccagaaggccatggacagccagaag
cagttcagcggtccagaaatccagttcctgctttcgtgctccgaagcggatgagaacgaa
atgatcaactgcgaagagttcgccaaccgcttccaggagccagcacgcgacatcggcttc
aacgtggcggtgctgctgaccaacctgtcggagcatgtgccgcatgaccctcgcctgcac
aacttcctggagctggccgagagcatccttgagtacttccgcccctacctgggccgcatc
gagatcatgggcgcgtcacgccgcatcgagcgcatctacttcgagatctcagagaccaac
cgcgcccagtgggagatgccccaggtgaaggagtccaagcgccagttcatcttcgacgtg
gtgaacgagggcggcgaggctgagaagatggagctcttcgtgagtttctgcgaggacacc
atcttcgagatgcagatcgccgcgcagatctcggagcccgagggcgagccggagaccgac
gaggacgagggcgcgggcgcggcggaggcgggcgcggaaggcgcggaggagggcgcggcg
gggctcgagggcacggcggccacggcggcggcgggggcgacggcgcgggttgtggcggcc
gcaggccgggccctgcgaggcctcagctaccgcagcctgcggcggcgcgtgcggcggctg
cggcggcttacggcccgcgaggcggccaccgcagtggcggcgctgctctgggcagcagtg
acgcgcgctggggccgctggcgcgggggcggcggcgggcgcgctgggcctgctctggggc
tcgctgttcggcggcggcctggtggagggcgccaagaaggtgacggtgaccgagctcctg
gcaggcatgcccgaccccaccagcgacgaggtgcacggcgagcagccggccgggccgggc
ggagacgcagacggcgagggtgccagcgagggcgctggagacgccgcggagggcgctgga
gacgaggaggaggcggtgcacgaggccgggccgggcggtgccgacggggcggtggccgtg
accgatgggggccccttccggcccgaaggggctggcggtctcggggacatgggggacacg
acgcctgcggaaccgcccacacccgagggctctcccatcctcaagaggaaattgggggtg
gatggagtggaggaggagctcccgccagagccagagcccgagccggaaccagagctggag
ccggagaaagccgatgccgagaatggggagaaggaagaagttcccgagcccacaccagag
ccccccaagaagcaagcacctccctcaccccctccaaagaaggaggaagctggaggcgaa
ttctggggagaactggaggtgcagagggtgaagttcctgaactacctgtcccggaacttt
tacaccctgcggttccttgccctcttcttggcatttgccatcaacttcatcttgctgttt
tataaggtctcagactctccaccaggggaggacgacatggaaggctcagctgctggggat
gtgtcaggtgcaggctctggtggcagctctggctggggcttgggggccggagaggaggca
gagggcgatgaggatgagaacatggtgtactacttcctggaggaaagcacaggctacatg
gaacccgccctgcggtgtctgagcctcctgcatacactggtggcctttctctgcatcatt
ggctataattgtctcaaggtgcccctggtaatctttaagcgggagaaggagctggcccgg
aagctggagtttgatggcctgtacatcacggagcagcctgaggacgatgacgtgaagggg
cagtgggaccgactggtgctcaacacgccgtctttccctagcaactactgggacaagttt
gtcaagcgcaaggtcctggacaaacatggggacatctacgggcgggagcggattgctgag
ctactgggcatggacctggccacactagagatcacagcccacaatgagcgcaagcccaac
ccgccgccagggctgctgacctggctcatgtccatcgatgtcaagtaccagatctggaag
ttcggggtcatcttcacagacaactccttcctgtacctgggctggtatatggtgatgtcc
ctcttgggacactacaacaacttcttctttgctgcccatctcctggacatcgccatgggg
gtcaagacgctgcgcaccatcctgtcctctgtcacccacaatgggaaacagctggtgatg
accgtgggccttctggcggtggtcgtctacctgtacaccgtggtggccttcaacttcttc
cgcaagttctacaacaagagcgaggatgaggatgaacctgacatgaagtgtgatgacatg
atgacgtgttacctgtttcacatgtacgtgggtgtccgggctggcggaggcattggggac
gagatcgaggaccccgcgggtgacgaatacgagctctacagggtggtcttcgacatcacc
ttcttcttcttcgtcatcgtcatcctgttggccatcatccagggtctgatcatcgacgct
tttggtgagctccgagaccaacaagagcaagtgaaggaggatatggagaccaagtgcttc
atctgtggaatcggcagtgactactttgatacgacaccgcatggcttcgagactcacacg
ctggaggagcacaacctggccaattacatgtttttcctgatgtatttgataaacaaggat
gagacagaacacacgggtcaggagtcttatgtctggaagatgtaccaagagagatgttgg
gatttcttcccagctggtgattgtttccgtaagcagtatgaggaccagcttagctga

DBGET integrated database retrieval system