KEGG   Homo sapiens (human): 6263Help
Entry
6263              CDS       T01001                                 

Gene name
RYR3
Definition
ryanodine receptor 3
Orthology
K04963  
ryanodine receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Circadian entrainment
Oxytocin signaling pathway
Salivary secretion
Alzheimer's disease
Drug target
Procaine: 
Dantrolene: 
Suramin sodium: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    6263 (RYR3)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    6263 (RYR3)
  Digestive system
   04970 Salivary secretion
    6263 (RYR3)
  Environmental adaptation
   04713 Circadian entrainment
    6263 (RYR3)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    6263 (RYR3)
Ion channels [BR:hsa04040]
 Ryanodine and IP3 receptors
  Ryanodine receptor (RYR)
   6263 (RYR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q14-q15
AA seq 4870 aa AA seqDB search
MAEGGEGGEDEIQFLRTEDEVVLQCIATIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYIP
PDLCVCNFVLEQSLSVRALQEMLANTGENGGEGAAQGGGHRTLLYGHAVLLRHSFSGMYL
TCLTTSRSQTDKLAFDVGLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSER
YLHLSVSNGNIQVDASFMQTLWNVHPTCSGSSIEEGYLLGGHVVRLFHGHDECLTIPSTD
QNDSQHRRIFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTED
QGLILQDRAKSDTKSTAFSFRASKELKEKLDSSHKRDIEGMGVPEIKYGDSVCFVQHIAS
GLWVTYKAQDAKTSRLGPLKRKVILHQEGHMDDGLTLQRCQREESQAARIIRNTTALFSQ
FVSGNNRTAAPITLPIEEVLQTLQDLIAYFQPPEEEMRHEDKQNKLRSLKNRQNLFKEEG
MLALVLNCIDRLNVYNSVAHFAGIAREESGMAWKEILNLLYKLLAALIRGNRNNCAQFSN
NLDWLISKLDRLESSSGILEVLHCILTESPEALNLIAEGHIKSIISLLDKHGRNHKVLDI
LCSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYKKW
YFELIIDQVDPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLW
SGRIPRAVASINQHLLRSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVMS
FSAGVKVRFLMGGRHGEFKFLPPSGYAPCYEALLPKEKMRLEPVKEYKRDADGIRDLLGT
TQFLSQASFIPCPVDTSQVILPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKR
QHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKLPKNYMMS
NGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLV
PYALLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADSAVEKVSIDKIRFFRVERSY
AVRSGKWYFEFEVVTGGDMRVGWARPGCRPDVELGADDQAFVFEGNRGQRWHQGSGYFGR
TWQPGDVVGCMINLDDASMIFTLNGELLITNKGSELAFADYEIENGFVPICCLGLSQIGR
MNLGTDASTFKFYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKDHPHIEVMRID
GTMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEI
LSHTTTQCYYAIRIFAGQDPSCVWVGWVTPDYHLYSEKFDLNKNCTVTVTLGDERGRVHE
SVKRSNCYMVWGGDIVASSQRSNRSNVDLEIGCLVDLAMGMLSFSANGKELGTCYQVEPN
TKVFPAVFLQPTSTSLFQFELGKLKNAMPLSAAIFRSEEKNPVPQCPPRLDVQTIQPVLW
SRMPNSFLKVETERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDLMRFHYH
TLRLYSAVCALGNSRVAYALCSHVDLSQLFYAIDNKYLPGLLRSGFYDLLISIHLASAKE
RKLMMKNEYIIPITSTTRNIRLFPDESKRHGLPGVGLRTCLKPGFRFSTPCFVVTGEDHQ
KQSPEIPLESLRTKALSMLTEAVQCSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDD
DDVRQILLLIDPSVFGEHSAGTEEGAEKEEVTQVEEKAVEAGEKAGKEAPVKGLLQTRLP
ESVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTA
RKTKEFRSPPQEQINMLLNFQLGENCPCPEEIREELYDFHEDLLLHCGVPLEEEEEEEED
TSWTGKLCALVYKIKGPPKPEKEQPTEEEERCPTTLKELISQTMICWAQEDQIQDSELVR
MMFNLLRRQYDSIGELLQALRKTYTISHTSVSDTINLLAALGQIRSLLSVRMGKEEELLM
INGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGTEKSQIAFPKMVASCCRFLCYF
CRISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAASSVMDNNELALSLEEPDLE
KVVTYLAGCGLQSCPMLLAKGYPDVGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKL
LIRRPECFGPALRGEGGNGLLAAMQGAIKISENPALDLPSQGYKREVSTGDDEEEEEIVH
MGNAIMSFYSALIDLLGRCAPEMHLIQTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLP
SLNKDGSVSEPDMAANFCPDHKAPMVLFLDRVYGIKDQTFLLHLLEVGFLPDLRASASLD
TVSLSTTEAALALNRYICSAVLPLLTRCAPLFAGTEHCTSLIDSTLQTIYRLSKGRSLTK
AQRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLNEYCKMPLKLLTNHYEQCWKYYCL
PSGWGSYGLAVEEELHLTEKLFWGIFDSLSHKKYDPDLFRMALPCLSAIAGALPPDYLDT
RITATLEKQISVDADGNFDPKPINTMNFSLPEKLEYIVTKYAEHSHDKWACDKSQSGWKY
GISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGEALVQQRE
NEKLRSVSQANQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKLELESKGG
GSHPLLVPYDTLTAKEKFKDREKAQDLFKFLQVNGIIVSRGMKDMELDASSMEKRFAYKF
LKKILKYVDSAQEFIAHLEAIVSSGKTEKSPRDQEIKFFAKVLLPLVDQYFTSHCLYFLS
SPLKPLSSSGYASHKEKEMVAGLFCKLAALVRHRISLFGSDSTTMVSCLHILAQTLDTRT
VMKSGSELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPI
LTSIFEHVTQHQFGMDLLLGDVQISCYHILCSLYSLGTGKNIYVERQRPALGECLASLAA
AIPVAFLEPTLNRYNPLSVFNTKTPRERSILGMPDTVEDMCPDIPQLEGLMKEINDLAES
GARYTEMPHVIEVILPMLCNYLSYWWERGPENLPPSTGPCCTKVTSEHLSLILGNILKII
NNNLGIDEASWMKRIAVYAQPIISKARPDLLRSHFIPTLEKLKKKAVKTVQEEEQLKADG
KGDTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRSNWLKSPDADSDQLFRMVAEVFI
LWCKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKAMQVKSGGQDQERKKTKRRGDLY
SIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKSRYSHRDTDEEVREHLRNNLHLQEKS
DDPAVKWQLNLYKDVLKSEEPFNPEKTVERVQRISAAVFHLEQVEQPLRSKKAVWHKLLS
KQRKRAVVACFRMAPLYNLPRHRSINLFLHGYQRFWIETEEYSFEEKLVQDLAKSPKVEE
EEEEETEKQPDPLHQIILYFSRNALTERSKLEDDPLYTSYSSMMAKSCQSGEDEEEDEDK
EKTFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMSPMVVETLKLGIAILNGGN
AGVQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTLIVRE
RGEKVLQNDEFTRDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTVNVIISTVDYLLRLQES
ISDFYWYYSGKDIIDESGQHNFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAV
VGFLHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLV
ESSTNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGIISKKEFQKAMEGQKQYTQSEID
FLLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAES
VLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQE
KMELFVNFCEDTIFEMQLASQISESDSADRPEEEEEDEDSSYVLEIAGEEEEDGSLEPAS
AFAMACASVKRNVTDFLKRATLKNLRKQYRNVKKMTAKELVKVLFSFFWMLFVGLFQLLF
TILGGIFQILWSTVFGGGLVEGAKNIRVTKILGDMPDPTQFGIHDDTMEAERAEVMEPGI
TTELVHFIKGEKGDTDIMSDLFGLHPKKEGSLKHGPEVGLGDLSEIIGKDEPPTLESTVQ
KKRKAQAAEMKAANEAEGKVESEKADMEDGEKEDKDKEEEQAEYLWTEVTKKKKRRCGQK
VEKPEAFTANFFKGLEIYQTKLLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEE
ETEDVANLWNSFNDEEEEEAMVFFVLQESTGYMAPTLRALAIIHTIISLVCVVGYYCLKV
PLVVFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVIN
KYGDLYGAERIAELLGLDKNALDFSPVEETKAEAASLVSWLSSIDMKYHIWKLGVVFTDN
SFLYLAWYTTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVV
VYLYTVVAFNFFRKFYNKSEDDDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGD
PYEMYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDY
FDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDC
FRKQYEDQLG
NT seq 14613 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagggggagaaggaggcgaggacgagatccagtttctgaggactgaggatgaa
gtggtactccagtgcatcgccaccattcataaggagcagaggaagttctgcctggcagcc
gagggacttgggaatcgcctgtgcttcttggaacccacttcagaagccaagtacattcct
ccagatctctgcgtctgcaattttgtgctggaacagtccctatctgtcagagccctgcag
gaaatgcttgccaacacaggtgaaaatggcggcgaaggggcagcacaaggaggtggccac
aggaccctgttatacggccatgcagttctcctgaggcactctttcagcggaatgtatcta
acatgcttgactacatcaagatcccagacagacaaacttgcctttgatgtaggtctacgg
gaacatgccacaggagaagcctgttggtggactatacatcctgcttccaaacagaggtcc
gaaggagagaaagttcgaattggcgatgacctcatcctcgtcagcgtgtcctctgaaaga
taccttcatctctcagtatcaaatggtaacatacaagtggatgcctcctttatgcaaaca
ctctggaatgtacatcctacgtgctcaggaagtagcatcgaagaaggatacctacttggt
gggcatgtagtacgtcttttccatggtcatgatgaatgtttgacgataccatctacagac
cagaatgattcccagcacaggaggatattctacgaagctgggggagctgggactcgagcc
aggtctctttggagagtggaaccccttcggataagctggagtggcagtaacatcagatgg
ggccaggctttccgactccggcatctcaccacaggccactacctggccttgacagaagac
caaggccttatactgcaagaccgggcaaagtcagacaccaagtccacagctttctctttc
cgggcatcaaaggaactcaaggagaaattagactccagtcacaagcgagacatagaaggc
atgggagttccagaaatcaagtatggagattctgtctgctttgtgcagcatatagccagt
ggtctgtgggtgacctacaaagcacaagacgccaaaacttcccgcctgggacctctaaaa
agaaaggtcatactccatcaggaaggccacatggatgatggattaacactgcagagatgc
cagcgtgaggagtcccaggctgctcggatcatccggaacactacagccttattcagccag
tttgtcagcggaaacaatcgcacagctgcccccatcaccctgcctatagaagaagtcctg
cagaccctacaggacttgatcgcctacttccagcccccagaggaggagatgcgacatgaa
gacaagcagaacaagctccgctcactcaaaaacagacaaaatcttttcaaggaagaggga
atgttggcccttgtcttaaattgcattgaccgcttaaatgtctacaatagcgtagcacac
tttgcagggattgcaagggaagagagtggcatggcctggaaagaaattctgaacctcctc
tacaaattgctggctgctctcattcgcggaaacagaaacaattgcgctcaattctccaat
aaccttgattggctcatcagtaaattggacagactagaatcttcctcaggtatcttggaa
gttttgcactgcatcttaactgaaagcccagaagccttaaatctgatagcggagggccac
atcaagtcgatcatctccctgttggataagcacgggcggaatcacaaggttctggatatc
ctgtgctccctctgtctctgcaatggggttgcagtgagagccaaccagaatctgatctgt
gacaacttgctgccccggagaaacctactcctgcagacacgactgattaacgatgtaacc
agtatccggccaaacatcttcctgggagtcgcggagggctcagcccagtacaagaagtgg
tacttcgagctgattatcgaccaggtggaccccttcctaacagcagagcccacacatctg
cgggtgggctgggcctcttcttcaggctatgccccatacccaggaggtggagaaggatgg
ggaggcaatggtgttggtgacgacctgtactcctatggctttgatggacttcacctttgg
tcaggccggatacccagagctgtggcttccatcaaccagcacctcctgagatcggatgac
gtggtaagctgctgcctggacctcggggtgcccagcatctcattccgcatcaatgggcag
cccgtgcaggggatgtttgagaacttcaacacagacgggctcttcttccctgtgatgagc
ttttcagcaggtgtcaaagtacgtttcctgatgggtggacgtcatggagagtttaagttc
ctgcctccctctggctatgccccttgctatgaagccttacttccaaaagagaagatgaga
ttggagcctgtcaaagaatataaacgtgatgctgatggcattagagatctcttgggtacc
acccagttcctctcccaagcctctttcatcccatgccccgtagacaccagtcaggttatt
ttgccacctcacctagaaaagatccgagacagactagctgaaaacatccatgagctttgg
ggaatgaataaaatagaacttggctggactttcggcaagatacgagatgacaataaaaga
caacacccttgccttgtggagttttcaaagctcccagaaactgagaagaactataacctg
caaatgtcaactgaaaccttaaaaaccctcttggccctggggtgccacattgctcatgtt
aacccagctgctgaggaggatctcaagaaggtcaaactgcccaaaaactatatgatgtcc
aacggctataagccagcccctttggatttgtctgatgtgaagctgttacctcctcaagaa
attttagtggataagcttgcagaaaatgcacacaatgtttgggcaaaagacagaataaaa
caaggatggacctatggcatccaacaggatttgaagaacaaaagaaatccccgtctggtg
ccatatgcattactggatgagcgtaccaagaagtcaaacagggacagcctgcgggaagct
gtgcgcacttttgttggttacgggtataacattgagccatcagaccaagaactagctgac
tcggctgtggagaaggtcagcatagacaagatccgatttttccgggtagagcgatcttat
gcagtgagatctggaaagtggtattttgagtttgaagtggtgactggaggagacatgcga
gtcggctgggcgaggccaggctgtcgacctgatgtcgagctgggggccgatgaccaagcc
tttgtgtttgaaggcaacaggggccagcgttggcatcaaggaagtgggtattttgggcgt
acctggcagccaggggatgtggtcggatgtatgattaacctggatgatgcttcaatgatc
ttcacactgaatggggagctgctgatcaccaacaaaggctctgaacttgccttcgctgac
tacgagattgagaatggcttcgtgcccatctgctgtctgggtctatctcagatcggccgc
atgaatctcgggacagatgccagtaccttcaagttttataccatgtgcggtctccaagag
ggctttgagccttttgctgtcaacatgaacagagatgttgctatgtggttcagcaagcgc
ctcccgacgtttgtcaacgtgccaaaggatcatccacacatagaggtcatgaggattgat
ggcaccatggacagccctccgtgtctcaaggtgacgcataagacatttggcacacagaat
agcaatgccgacatgatctattgccgcttgagcatgcctgtcgagtgccactcctccttc
agccacagcccctgtctggacagtgaagctttccagaaaaggaaacagatgcaagaaata
ctctctcatacaacaacacagtgctactacgccatccgcatctttgctggacaggatcca
tcctgtgtctgggtcggatgggtgactccagactatcacttgtacagtgaaaagtttgac
ctgaataaaaactgcacagtgactgtcaccctaggggatgaaagaggccgggtccatgaa
agtgtgaaacgcagcaactgctacatggtctggggtggagacattgtagccagttcccag
agatcaaatcggagcaacgtggacctggagatcggctgtctcgtggatctggccatgggc
atgttgtccttctcagccaatggaaaggaactgggcacctgctaccaggtggagcctaat
accaaagtgtttccagcagtcttcctgcagcctacaagtacttctttgtttcagtttgaa
cttggaaagctgaagaacgcaatgcccctgtcagcggccatattcaggagtgaagagaag
aacccagtcccacagtgtccacctcggctggacgtccaaaccatccagcccgtgctctgg
agccgcatgcccaacagcttcctgaaggtggagaccgagcgtgtgagcgagcgccacggc
tgggtggtgcagtgcctggagcccctgcagatgatggcgctccacatccccgaggagaac
aggtgtgtggatatcctggagctctgtgagcaggaggacctgatgcggttccattaccac
acgctgaggctctacagcgcggtgtgcgccctgggaaacagccgcgtggcctacgccctg
tgcagccacgtggacctctcccagctcttctatgccattgacaacaagtacctccccggc
ctccttcgatctggtttctatgacctgctcatcagcatccacctggccagcgccaaggag
aggaagctgatgatgaagaacgagtacatcatccccattaccagcaccaccaggaatatc
cgcctcttcccggacgagtccaagaggcatggactgcctggggtgggcctgagaacatgt
ctcaagcccgggttcaggttctccaccccttgctttgttgtgactggtgaggatcaccaa
aagcagagccccgagattcccttggagagtctcaggacgaaggctctgagtatgctgaca
gaggcagtgcagtgcagcggggcccacatccgagaccctgtaggggggtctgtggagttc
cagtttgtgcctgtgctgaaactcattggaaccctgctggtcatgggcgtgtttgatgat
gatgatgttcggcagatcctcctcctgattgatccctctgtgtttggggagcatagtgcg
gggacagaggagggagcagaaaaggaggaagtgacccaggtggaggagaaggctgtggag
gctggggagaaggccggcaaggaggctcctgtcaaaggcttgttgcagactcgattaccc
gaatccgtcaagctgcagatgtgtgagctcctcagctatctctgcgactgtgagctgcag
caccgagtggaggccattgtggcatttggtgacatttatgtctccaagctgcaggcaaat
cagaagttccgctacaatgagctcatgcaggccctgaacatgtctgcggccctgactgcc
cggaagaccaaggagttccgctcacccccacaggagcagatcaacatgctgcttaacttt
caactgggagagaactgcccctgcccagaggagattcgggaggagctgtatgatttccat
gaggaccttctccttcactgtggggttcctttggaagaagaggaagaggaggaggaggac
acctcctggacaggaaaactctgtgccttggtttacaaaatcaaaggcccacccaagcca
gagaaggagcagccgacggaggaggaggagagatgccccacaacattgaaggaactcatc
tcacagacgatgatctgctgggcccaggaggaccagatccaggattcagagctggtccga
atgatgttcaacctcctccggaggcagtatgacagcattggggagctgctgcaggcgctg
cggaagacctacaccatcagccacacctctgtaagcgacaccatcaacctgctggctgcc
ctgggccaaatccgctccctcctcagtgtcaggatgggcaaggaagaggagttgctcatg
atcaatgggctgggagacataatgaacaacaaggtgttttaccagcatcccaacctcatg
agagtcctgggcatgcacgagacggtgatggaggtgatggtgaacgtgttgggtacagag
aaatctcagattgcatttccaaagatggttgctagctgctgccgtttcctttgctatttc
tgtcgaattagccggcaaaatcagaaggccatgtttgagcatctgagttatcttctggag
aatagcagtgttggcctagcctccccgtcgatgaggggatccaccccgctggatgtggca
gcttcctctgtgatggacaacaatgagttagcgctgagcttagaggaaccagacctcgag
aaggtggtgacctacttggcaggctgtggcctacagagctgccccatgcttctggccaaa
ggataccctgatgtcggctggaaccccattgaaggggaacgctacctgtccttcctgagg
tttgctgtcttcgtgaacagtgagagtgtggaagaaaacgccagcgttgtggtcaagctg
ctcatcagacgcccagagtgcttcggcccggccctgcggggtgaggggggaaacgggctc
ttggcagccatgcagggtgccattaagatctctgagaacccagcgctcgacctcccctct
caaggatacaaaagagaagtcagcacgggggacgatgaagaggaagaagaaatcgtgcat
atgggcaatgcaattatgtcattttattcggcccttatagatctactgggccgctgtgct
cctgaaatgcacctcatccagacaggaaagggggaagccatccgcatcaggtccatcctg
cgctccctggtccccacagaagacctggttgggatcatcagcatccccttgaaactgccc
tccctcaacaaagatgggtcggtcagtgagccagatatggcggccaatttctgccctgac
cacaaggcacctatggtgctgttcttggaccgcgtttatggcattaaggatcaaactttt
ctgctccacttgctggaggttggatttttacctgacctaagagcttctgcctctctagat
acagtttccctaagcaccacagaggctgcgcttgcactaaataggtatatatgttctgct
gtgctcccgctcctcacaagatgtgcccctctctttgccggaacagaacactgcacctct
ctgattgattccacactgcagacaatatacaggctatccaagggacgttccctcaccaaa
gcacaaagggacactatagaagaatgtttgcttgccatttgcaatcacttgaggccttcc
atgttacagcaactcctgcgacgcctcgtttttgatgtgccgcaactcaatgaatactgc
aaaatgcctctcaagcttctgacgaatcactatgaacagtgttggaagtattactgcctg
ccttcaggatgggggagctacgggctagctgtggaagaagagctgcacctaacggagaag
cttttctgggggatttttgactcgctctcccataagaaatatgacccagatcttttccga
atggccctgccttgtctcagtgctatagctggggccttgccaccagattatttagatacc
agaatcacagccacgttggagaaacagatctcagtggatgcggatggcaactttgaccca
aaacctattaacaccatgaatttttccttgcctgaaaaattggaatacatcgtcaccaag
tatgctgagcattcacatgataaatgggcctgtgacaagagtcagagtggatggaaatat
gggatttccctggatgaaaatgtgaagacccacccactgataaggcctttcaagacatta
acggagaaggagaaggaaatttatcgctggcctgcgcgagagtccctgaaaaccatgctg
gctgtgggctggactgtggagaggaccaaagagggagaagctttggttcaacagcgggaa
aatgagaagcttcgaagtgtgtcccaggccaaccagggcaacagctacagtcctgctccc
ctcgacctctcaaacgttgtgctctccagagagctccagggaatggtggaggtcgtggct
gagaactatcacaatatctgggccaagaagaagaagctggagctggagagcaaaggtggt
ggcagccaccctcttctggtaccatatgacaccttgactgccaaggaaaagttcaaggac
cgggagaaggcacaggacctgtttaagttcctccaagtgaatggcatcatagtttccagg
ggtatgaaggatatggagctggatgcctcctccatggagaagaggtttgcctataagttc
ttgaagaagatcctgaaatacgttgattctgctcaagaatttattgcccatttagaagcc
attgtcagcagtgggaaaactgaaaagtctccccgtgaccaggagatcaaattctttgcc
aaagttctcctcccgctggttgaccagtacttcaccagtcattgcctctacttcttgtca
tcccctctgaagccccttagcagcagcggatatgcctcccataaggagaaagaaatggtg
gccggcctgttctgcaaacttgccgctctcgttagacacagaatttccctctttggtagt
gattctactacaatggtgagctgtcttcacatcttagctcagacacttgacacaaggact
gtcatgaagtcaggctcagagctggtgaaggctgggttacgagcattctttgaaaatgct
gcagaagatttggagaagacttcagaaaacctgaaacttgggaagttcacccattcccga
acgcagattaaaggcgtttctcagaatattaactacactacagtggctctgctccccatc
ctgacgtccatctttgagcacgtcactcagcatcagtttggaatggatctactcttgggt
gatgtgcagatttcatgctaccacatactgtgcagcctctactcccttgggacgggaaag
aacatttatgttgaaaggcaacgccctgcccttggagaatgtctggcctcgctggcagct
gccataccagtggcattcctggagcccacccttaatcgctacaatccactctcggtcttc
aacaccaaaacccccagggagaggtctattctggggatgccagacacggtagaagacatg
tgtcctgacatcccccagctggaaggcctgatgaaggaaatcaacgacctggccgagtca
ggggcccggtacacagagatgccccatgtcatcgaggtgatcttacccatgctctgcaac
tacttgtcctactggtgggagcggggtcctgagaacctgccccccagcacagggccatgc
tgcaccaaggtcacctctgaacacctcagtctcatcctgggcaacattctgaaaatcatc
aacaacaacctgggcatcgatgaggcctcctggatgaagcgcattgcagtgtatgcacag
cccatcatcagcaaagccaggcccgacctgctgagaagccacttcatcccaactctggag
aagctgaagaaaaaggctgtcaagacggtgcaggaggaggagcagttgaaagccgatggc
aaaggggacacccaggaggcagaactcctcatcctggacgagttcgcggtcctctgcaga
gatctctatgccttctaccccatgctgatccgctacgtggacaacaacagatctaactgg
ctgaaaagtcctgatgctgattctgaccagctcttccgcatggtggcagaagtcttcatt
ctgtggtgtaaatctcataacttcaagagagaagagcaaaattttgtgattcagaatgaa
attaataatttggcatttttaactggagacagcaaaagcaagatgtcaaaagccatgcaa
gtaaagtctggaggacaagaccaggagcggaagaagacaaagcggcggggagacttgtat
tccatccagacctccctcatcgtggctgcactcaagaaaatgctgcccattggtttgaat
atgtgtactccaggcgaccaggagctgatctccctcgcaaaatcgcgatacagccatagg
gacacagatgaagaggtcagagaacatctgcggaacaacttgcacttgcaggaaaagtct
gatgacccagctgtaaaatggcaactgaacctctacaaggatgttctgaagagtgaagaa
cctttcaatccggaaaagacagtggagcgtgtgcagagaatttcagcagctgtcttccac
ctggaacaggtggaacagcctttgaggtccaagaaggccgtctggcacaaactgttatca
aagcaacggaaacgggcagtggtggcctgtttcaggatggcccctctctacaacctgccc
aggcaccgctctattaacctcttcctccatggctatcagagattttggatagaaacagag
gagtattcctttgaagagaaactagtacaggatttggctaaatctccaaaggtggaagag
gaggaggaggaagagacagaaaaacaacctgacccactacatcagatcattctctatttt
agccgcaacgctctcacggagaggagcaaattggaagacgaccctttgtacacctcctat
tccagcatgatggccaagagttgtcaaagtggtgaggatgaagaagaagatgaagacaag
gaaaaaacattcgaagagaaagagatggagaagcaaaaaaccctctatcagcaagctcgg
ctgcatgagcgtggtgctgcagagatggtccttcagatgataagcgctagcaaaggtgag
atgagccccatggtggttgagacgctgaagctggggatcgccattctgaacggaggcaat
gctggtgtgcaacagaaaatgctagattacctaaaggagaaaaaggatgctggattcttt
caaagcctttctggtcttatgcagtcttgcagtgtccttgatttgaatgcatttgagagg
cagaataaagctgaaggcctggggatggtgactgaagaaggaacactcattgttcgggaa
cgtggtgaaaaagtactccagaatgacgagttcacgcgtgatctctttagattcctacag
ttactttgtgagggacataacagtgactttcagaacttcctgcggactcagatgggcaac
accaccaccgtgaatgtcatcatcagcactgtggactaccttctgcgtctgcaggaatca
atcagtgatttctactggtattattcagggaaggacatcattgatgaatctggacagcac
aatttttccaaagctctggcagtcaccaagcagattttcaattctcttacagaatacatc
cagggcccttgcattggtaatcaacagagcctggctcacagcaggctgtgggacgcagtg
gttggcttcctccatgtctttgctaatatgcagatgaaactctctcaggattccagtcag
atcgagctgctgaaggaactcttggatctccttcaggacatggtggtgatgcttctgtcc
ctcctggaagggaatgtggtaaatggcaccattggcaagcagatggttgacacactggta
gaatcatctaccaatgtagaaatgatcttgaaattctttgacatgttcttgaaacttaaa
gacttaaccagctcagacaccttcaaagaatatgacccagatggtaaaggaattatctcc
aaaaaagaattccagaaggccatggaagggcaaaaacagtacacgcagtcagagattgac
tttctcctgtcgtgtgcagaagctgatgagaatgacatgtttaattacgttgattttgta
gaccggttccatgagccagccaaggacatagggtttaatgtggctgtgttattgacaaat
ctttctgaacacatgccaaacgattcccgcctgaagtgtctgttggacccagcagaaagt
gtgctaaattacttcgaaccctacctaggacgcatcgagatcatgggtggggccaagaag
attgagcgtgtttattttgagatcagtgaatccagtcgcactcagtgggagaagccccag
gtgaaggaatctaagcgacagttcatttttgatgttgtcaatgaaggtggggagcaggaa
aagatggagctgtttgtgaacttctgtgaggacaccatctttgaaatgcagttagcatct
cagatctctgaatccgattcagctgacaggccagaagaggaggaagaagatgaagattct
tcttacgtgttagaaattgcgggtgaagaggaagaagacgggtctcttgagccggcctct
gcatttgctatggcctgtgcctctgtgaagaggaatgtcaccgacttcctgaagagagca
accctgaagaacctcaggaagcagtacaggaacgtgaaaaagatgactgcgaaggagctg
gtgaaggtgctcttctcctttttctggatgctgttcgtggggctattccagttgctcttc
accatcctgggaggaatctttcagatcctctggagcacagtgtttggagggggcctggta
gaaggggcaaagaacatcagagtgaccaagatcctgggtgacatgcctgacccaacccaa
tttggtatccatgatgacactatggaggctgagagggcagaggtgatggagccaggtatc
accactgaactagtacacttcataaagggggagaagggagatacagatatcatgtcagac
ctctttggactccacccaaagaaagagggcagcttaaagcatgggcctgaagtgggtttg
ggtgacctctcagaaattattggcaaggatgaaccccctacattagagagtactgtacag
aagaagaggaaagctcaggcagcagaaatgaaagcagcaaatgaagcagaaggaaaagta
gaatccgagaaggcagacatggaagatggagagaaggaagacaaagacaaagaagaggag
caagctgagtacctgtggacagaagtgacaaaaaagaagaagcggcggtgtggtcagaag
gttgagaagccggaagctttcacagccaatttctttaaagggctggaaatctatcagacc
aagttactgcattacctggccaggaatttctacaacctgaggttccttgctctgtttgta
gccttcgctatcaacttcatcctgcttttttataaggtcactgaagaacctttagaagaa
gagacagaggatgttgcaaacctatggaattcctttaatgacgaggaagaggaagaagcg
atggtattctttgtccttcaggagagcaccgggtatatggcaccaaccctgcgtgccctg
gccatcatccataccatcatctctctagtctgtgtggtgggctactactgcctgaaggtg
cctttggtggttttcaaaagggaaaaagaaatcgccaggaagctggagtttgatggccta
tatatcaccgaacagccatctgaagatgacatcaaggggcagtgggaccgcttggtgatc
aacacaccatcttttcctaataactactgggacaagtttgtaaagagaaaggtgatcaac
aagtatggagatctctacggagcagaacgcattgctgaacttctgggtttggacaaaaat
gctcttgactttagcccagtagaagagaccaaagcagaagcggcttctctggtgtcatgg
ctaagttccatagacatgaagtaccatatctggaagcttggagttgtttttactgacaac
tcctttctctaccttgcctggtatacaaccatgtcagtcctgggccactacaataacttc
ttctttgctgctcacctattggacatcgcaatgggcttcaagacactgaggaccattctg
tcatctgtaactcacaatggcaaacagttggttctgactgtcggtctcctggccgtggtg
gtttatctctatactgtggtggctttcaacttcttccgcaagttctacaacaaaagcgaa
gacgatgacgagcccgatatgaagtgcgacgacatgatgacgtgttaccttttccacatg
tacgtgggagtgagagcaggaggtggcattggtgatgaaattgaagaccctgctggtgat
ccttatgaaatgtatcgcattgtctttgacattacctttttcttcttcgtcattgtcatc
ttgctggccatcattcaaggtcttattattgatgctttcggagagctaagagaccagcag
gaacaagtacgagaagatatggagactaaatgtttcatctgtgggattggcaatgactac
tttgacacaacccctcatggttttgaaacacatacattacaagagcacaacttagccaac
tacttgttctttctgatgtatttgattaataaagatgaaacagagcacacgggtcaggaa
tcttatgtctggaagatgtaccaagaaaggtgttgggatttcttcccagccggtgactgc
tttcgtaaacaatatgaagatcagcttggataa

DBGET integrated database retrieval system