KEGG   Homo sapiens (human): 6263Help
Entry
6263              CDS       T01001                                 

Gene name
RYR3
Definition
ryanodine receptor 3
Orthology
K04963  
ryanodine receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Circadian entrainment
Oxytocin signaling pathway
Salivary secretion
Alzheimer's disease
Drug target
Procaine: 
Dantrolene: 
Suramin sodium: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:hsa04713]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q14-q15
AA seq 4870 aa AA seqDB search
MAEGGEGGEDEIQFLRTEDEVVLQCIATIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYIP
PDLCVCNFVLEQSLSVRALQEMLANTGENGGEGAAQGGGHRTLLYGHAVLLRHSFSGMYL
TCLTTSRSQTDKLAFDVGLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSER
YLHLSVSNGNIQVDASFMQTLWNVHPTCSGSSIEEGYLLGGHVVRLFHGHDECLTIPSTD
QNDSQHRRIFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTED
QGLILQDRAKSDTKSTAFSFRASKELKEKLDSSHKRDIEGMGVPEIKYGDSVCFVQHIAS
GLWVTYKAQDAKTSRLGPLKRKVILHQEGHMDDGLTLQRCQREESQAARIIRNTTALFSQ
FVSGNNRTAAPITLPIEEVLQTLQDLIAYFQPPEEEMRHEDKQNKLRSLKNRQNLFKEEG
MLALVLNCIDRLNVYNSVAHFAGIAREESGMAWKEILNLLYKLLAALIRGNRNNCAQFSN
NLDWLISKLDRLESSSGILEVLHCILTESPEALNLIAEGHIKSIISLLDKHGRNHKVLDI
LCSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYKKW
YFELIIDQVDPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLW
SGRIPRAVASINQHLLRSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVMS
FSAGVKVRFLMGGRHGEFKFLPPSGYAPCYEALLPKEKMRLEPVKEYKRDADGIRDLLGT
TQFLSQASFIPCPVDTSQVILPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKR
QHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKLPKNYMMS
NGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLV
PYALLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADSAVEKVSIDKIRFFRVERSY
AVRSGKWYFEFEVVTGGDMRVGWARPGCRPDVELGADDQAFVFEGNRGQRWHQGSGYFGR
TWQPGDVVGCMINLDDASMIFTLNGELLITNKGSELAFADYEIENGFVPICCLGLSQIGR
MNLGTDASTFKFYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKDHPHIEVMRID
GTMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEI
LSHTTTQCYYAIRIFAGQDPSCVWVGWVTPDYHLYSEKFDLNKNCTVTVTLGDERGRVHE
SVKRSNCYMVWGGDIVASSQRSNRSNVDLEIGCLVDLAMGMLSFSANGKELGTCYQVEPN
TKVFPAVFLQPTSTSLFQFELGKLKNAMPLSAAIFRSEEKNPVPQCPPRLDVQTIQPVLW
SRMPNSFLKVETERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDLMRFHYH
TLRLYSAVCALGNSRVAYALCSHVDLSQLFYAIDNKYLPGLLRSGFYDLLISIHLASAKE
RKLMMKNEYIIPITSTTRNIRLFPDESKRHGLPGVGLRTCLKPGFRFSTPCFVVTGEDHQ
KQSPEIPLESLRTKALSMLTEAVQCSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDD
DDVRQILLLIDPSVFGEHSAGTEEGAEKEEVTQVEEKAVEAGEKAGKEAPVKGLLQTRLP
ESVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTA
RKTKEFRSPPQEQINMLLNFQLGENCPCPEEIREELYDFHEDLLLHCGVPLEEEEEEEED
TSWTGKLCALVYKIKGPPKPEKEQPTEEEERCPTTLKELISQTMICWAQEDQIQDSELVR
MMFNLLRRQYDSIGELLQALRKTYTISHTSVSDTINLLAALGQIRSLLSVRMGKEEELLM
INGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGTEKSQIAFPKMVASCCRFLCYF
CRISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAASSVMDNNELALSLEEPDLE
KVVTYLAGCGLQSCPMLLAKGYPDVGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKL
LIRRPECFGPALRGEGGNGLLAAMQGAIKISENPALDLPSQGYKREVSTGDDEEEEEIVH
MGNAIMSFYSALIDLLGRCAPEMHLIQTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLP
SLNKDGSVSEPDMAANFCPDHKAPMVLFLDRVYGIKDQTFLLHLLEVGFLPDLRASASLD
TVSLSTTEAALALNRYICSAVLPLLTRCAPLFAGTEHCTSLIDSTLQTIYRLSKGRSLTK
AQRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLNEYCKMPLKLLTNHYEQCWKYYCL
PSGWGSYGLAVEEELHLTEKLFWGIFDSLSHKKYDPDLFRMALPCLSAIAGALPPDYLDT
RITATLEKQISVDADGNFDPKPINTMNFSLPEKLEYIVTKYAEHSHDKWACDKSQSGWKY
GISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGEALVQQRE
NEKLRSVSQANQGNSYSPAPLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKLELESKGG
GSHPLLVPYDTLTAKEKFKDREKAQDLFKFLQVNGIIVSRGMKDMELDASSMEKRFAYKF
LKKILKYVDSAQEFIAHLEAIVSSGKTEKSPRDQEIKFFAKVLLPLVDQYFTSHCLYFLS
SPLKPLSSSGYASHKEKEMVAGLFCKLAALVRHRISLFGSDSTTMVSCLHILAQTLDTRT
VMKSGSELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPI
LTSIFEHVTQHQFGMDLLLGDVQISCYHILCSLYSLGTGKNIYVERQRPALGECLASLAA
AIPVAFLEPTLNRYNPLSVFNTKTPRERSILGMPDTVEDMCPDIPQLEGLMKEINDLAES
GARYTEMPHVIEVILPMLCNYLSYWWERGPENLPPSTGPCCTKVTSEHLSLILGNILKII
NNNLGIDEASWMKRIAVYAQPIISKARPDLLRSHFIPTLEKLKKKAVKTVQEEEQLKADG
KGDTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRSNWLKSPDADSDQLFRMVAEVFI
LWCKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKAMQVKSGGQDQERKKTKRRGDLY
SIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKSRYSHRDTDEEVREHLRNNLHLQEKS
DDPAVKWQLNLYKDVLKSEEPFNPEKTVERVQRISAAVFHLEQVEQPLRSKKAVWHKLLS
KQRKRAVVACFRMAPLYNLPRHRSINLFLHGYQRFWIETEEYSFEEKLVQDLAKSPKVEE
EEEEETEKQPDPLHQIILYFSRNALTERSKLEDDPLYTSYSSMMAKSCQSGEDEEEDEDK
EKTFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMSPMVVETLKLGIAILNGGN
AGVQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTLIVRE
RGEKVLQNDEFTRDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTVNVIISTVDYLLRLQES
ISDFYWYYSGKDIIDESGQHNFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAV
VGFLHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLV
ESSTNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGIISKKEFQKAMEGQKQYTQSEID
FLLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAES
VLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQE
KMELFVNFCEDTIFEMQLASQISESDSADRPEEEEEDEDSSYVLEIAGEEEEDGSLEPAS
AFAMACASVKRNVTDFLKRATLKNLRKQYRNVKKMTAKELVKVLFSFFWMLFVGLFQLLF
TILGGIFQILWSTVFGGGLVEGAKNIRVTKILGDMPDPTQFGIHDDTMEAERAEVMEPGI
TTELVHFIKGEKGDTDIMSDLFGLHPKKEGSLKHGPEVGLGDLSEIIGKDEPPTLESTVQ
KKRKAQAAEMKAANEAEGKVESEKADMEDGEKEDKDKEEEQAEYLWTEVTKKKKRRCGQK
VEKPEAFTANFFKGLEIYQTKLLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEE
ETEDVANLWNSFNDEEEEEAMVFFVLQESTGYMAPTLRALAIIHTIISLVCVVGYYCLKV
PLVVFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVIN
KYGDLYGAERIAELLGLDKNALDFSPVEETKAEAASLVSWLSSIDMKYHIWKLGVVFTDN
SFLYLAWYTTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVV
VYLYTVVAFNFFRKFYNKSEDDDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGD
PYEMYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDY
FDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDC
FRKQYEDQLG
NT seq 14613 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagggggagaaggaggcgaggacgagatccagtttctgaggactgaggatgaa
gtggtactccagtgcatcgccaccattcataaggagcagaggaagttctgcctggcagcc
gagggacttgggaatcgcctgtgcttcttggaacccacttcagaagccaagtacattcct
ccagatctctgcgtctgcaattttgtgctggaacagtccctatctgtcagagccctgcag
gaaatgcttgccaacacaggtgaaaatggcggcgaaggggcagcacaaggaggtggccac
aggaccctgttatacggccatgcagttctcctgaggcactctttcagcggaatgtatcta
acatgcttgactacatcaagatcccagacagacaaacttgcctttgatgtaggtctacgg
gaacatgccacaggagaagcctgttggtggactatacatcctgcttccaaacagaggtcc
gaaggagagaaagttcgaattggcgatgacctcatcctcgtcagcgtgtcctctgaaaga
taccttcatctctcagtatcaaatggtaacatacaagtggatgcctcctttatgcaaaca
ctctggaatgtacatcctacgtgctcaggaagtagcatcgaagaaggatacctacttggt
gggcatgtagtacgtcttttccatggtcatgatgaatgtttgacgataccatctacagac
cagaatgattcccagcacaggaggatattctacgaagctgggggagctgggactcgagcc
aggtctctttggagagtggaaccccttcggataagctggagtggcagtaacatcagatgg
ggccaggctttccgactccggcatctcaccacaggccactacctggccttgacagaagac
caaggccttatactgcaagaccgggcaaagtcagacaccaagtccacagctttctctttc
cgggcatcaaaggaactcaaggagaaattagactccagtcacaagcgagacatagaaggc
atgggagttccagaaatcaagtatggagattctgtctgctttgtgcagcatatagccagt
ggtctgtgggtgacctacaaagcacaagacgccaaaacttcccgcctgggacctctaaaa
agaaaggtcatactccatcaggaaggccacatggatgatggattaacactgcagagatgc
cagcgtgaggagtcccaggctgctcggatcatccggaacactacagccttattcagccag
tttgtcagcggaaacaatcgcacagctgcccccatcaccctgcctatagaagaagtcctg
cagaccctacaggacttgatcgcctacttccagcccccagaggaggagatgcgacatgaa
gacaagcagaacaagctccgctcactcaaaaacagacaaaatcttttcaaggaagaggga
atgttggcccttgtcttaaattgcattgaccgcttaaatgtctacaatagcgtagcacac
tttgcagggattgcaagggaagagagtggcatggcctggaaagaaattctgaacctcctc
tacaaattgctggctgctctcattcgcggaaacagaaacaattgcgctcaattctccaat
aaccttgattggctcatcagtaaattggacagactagaatcttcctcaggtatcttggaa
gttttgcactgcatcttaactgaaagcccagaagccttaaatctgatagcggagggccac
atcaagtcgatcatctccctgttggataagcacgggcggaatcacaaggttctggatatc
ctgtgctccctctgtctctgcaatggggttgcagtgagagccaaccagaatctgatctgt
gacaacttgctgccccggagaaacctactcctgcagacacgactgattaacgatgtaacc
agtatccggccaaacatcttcctgggagtcgcggagggctcagcccagtacaagaagtgg
tacttcgagctgattatcgaccaggtggaccccttcctaacagcagagcccacacatctg
cgggtgggctgggcctcttcttcaggctatgccccatacccaggaggtggagaaggatgg
ggaggcaatggtgttggtgacgacctgtactcctatggctttgatggacttcacctttgg
tcaggccggatacccagagctgtggcttccatcaaccagcacctcctgagatcggatgac
gtggtaagctgctgcctggacctcggggtgcccagcatctcattccgcatcaatgggcag
cccgtgcaggggatgtttgagaacttcaacacagacgggctcttcttccctgtgatgagc
ttttcagcaggtgtcaaagtacgtttcctgatgggtggacgtcatggagagtttaagttc
ctgcctccctctggctatgccccttgctatgaagccttacttccaaaagagaagatgaga
ttggagcctgtcaaagaatataaacgtgatgctgatggcattagagatctcttgggtacc
acccagttcctctcccaagcctctttcatcccatgccccgtagacaccagtcaggttatt
ttgccacctcacctagaaaagatccgagacagactagctgaaaacatccatgagctttgg
ggaatgaataaaatagaacttggctggactttcggcaagatacgagatgacaataaaaga
caacacccttgccttgtggagttttcaaagctcccagaaactgagaagaactataacctg
caaatgtcaactgaaaccttaaaaaccctcttggccctggggtgccacattgctcatgtt
aacccagctgctgaggaggatctcaagaaggtcaaactgcccaaaaactatatgatgtcc
aacggctataagccagcccctttggatttgtctgatgtgaagctgttacctcctcaagaa
attttagtggataagcttgcagaaaatgcacacaatgtttgggcaaaagacagaataaaa
caaggatggacctatggcatccaacaggatttgaagaacaaaagaaatccccgtctggtg
ccatatgcattactggatgagcgtaccaagaagtcaaacagggacagcctgcgggaagct
gtgcgcacttttgttggttacgggtataacattgagccatcagaccaagaactagctgac
tcggctgtggagaaggtcagcatagacaagatccgatttttccgggtagagcgatcttat
gcagtgagatctggaaagtggtattttgagtttgaagtggtgactggaggagacatgcga
gtcggctgggcgaggccaggctgtcgacctgatgtcgagctgggggccgatgaccaagcc
tttgtgtttgaaggcaacaggggccagcgttggcatcaaggaagtgggtattttgggcgt
acctggcagccaggggatgtggtcggatgtatgattaacctggatgatgcttcaatgatc
ttcacactgaatggggagctgctgatcaccaacaaaggctctgaacttgccttcgctgac
tacgagattgagaatggcttcgtgcccatctgctgtctgggtctatctcagatcggccgc
atgaatctcgggacagatgccagtaccttcaagttttataccatgtgcggtctccaagag
ggctttgagccttttgctgtcaacatgaacagagatgttgctatgtggttcagcaagcgc
ctcccgacgtttgtcaacgtgccaaaggatcatccacacatagaggtcatgaggattgat
ggcaccatggacagccctccgtgtctcaaggtgacgcataagacatttggcacacagaat
agcaatgccgacatgatctattgccgcttgagcatgcctgtcgagtgccactcctccttc
agccacagcccctgtctggacagtgaagctttccagaaaaggaaacagatgcaagaaata
ctctctcatacaacaacacagtgctactacgccatccgcatctttgctggacaggatcca
tcctgtgtctgggtcggatgggtgactccagactatcacttgtacagtgaaaagtttgac
ctgaataaaaactgcacagtgactgtcaccctaggggatgaaagaggccgggtccatgaa
agtgtgaaacgcagcaactgctacatggtctggggtggagacattgtagccagttcccag
agatcaaatcggagcaacgtggacctggagatcggctgtctcgtggatctggccatgggc
atgttgtccttctcagccaatggaaaggaactgggcacctgctaccaggtggagcctaat
accaaagtgtttccagcagtcttcctgcagcctacaagtacttctttgtttcagtttgaa
cttggaaagctgaagaacgcaatgcccctgtcagcggccatattcaggagtgaagagaag
aacccagtcccacagtgtccacctcggctggacgtccaaaccatccagcccgtgctctgg
agccgcatgcccaacagcttcctgaaggtggagaccgagcgtgtgagcgagcgccacggc
tgggtggtgcagtgcctggagcccctgcagatgatggcgctccacatccccgaggagaac
aggtgtgtggatatcctggagctctgtgagcaggaggacctgatgcggttccattaccac
acgctgaggctctacagcgcggtgtgcgccctgggaaacagccgcgtggcctacgccctg
tgcagccacgtggacctctcccagctcttctatgccattgacaacaagtacctccccggc
ctccttcgatctggtttctatgacctgctcatcagcatccacctggccagcgccaaggag
aggaagctgatgatgaagaacgagtacatcatccccattaccagcaccaccaggaatatc
cgcctcttcccggacgagtccaagaggcatggactgcctggggtgggcctgagaacatgt
ctcaagcccgggttcaggttctccaccccttgctttgttgtgactggtgaggatcaccaa
aagcagagccccgagattcccttggagagtctcaggacgaaggctctgagtatgctgaca
gaggcagtgcagtgcagcggggcccacatccgagaccctgtaggggggtctgtggagttc
cagtttgtgcctgtgctgaaactcattggaaccctgctggtcatgggcgtgtttgatgat
gatgatgttcggcagatcctcctcctgattgatccctctgtgtttggggagcatagtgcg
gggacagaggagggagcagaaaaggaggaagtgacccaggtggaggagaaggctgtggag
gctggggagaaggccggcaaggaggctcctgtcaaaggcttgttgcagactcgattaccc
gaatccgtcaagctgcagatgtgtgagctcctcagctatctctgcgactgtgagctgcag
caccgagtggaggccattgtggcatttggtgacatttatgtctccaagctgcaggcaaat
cagaagttccgctacaatgagctcatgcaggccctgaacatgtctgcggccctgactgcc
cggaagaccaaggagttccgctcacccccacaggagcagatcaacatgctgcttaacttt
caactgggagagaactgcccctgcccagaggagattcgggaggagctgtatgatttccat
gaggaccttctccttcactgtggggttcctttggaagaagaggaagaggaggaggaggac
acctcctggacaggaaaactctgtgccttggtttacaaaatcaaaggcccacccaagcca
gagaaggagcagccgacggaggaggaggagagatgccccacaacattgaaggaactcatc
tcacagacgatgatctgctgggcccaggaggaccagatccaggattcagagctggtccga
atgatgttcaacctcctccggaggcagtatgacagcattggggagctgctgcaggcgctg
cggaagacctacaccatcagccacacctctgtaagcgacaccatcaacctgctggctgcc
ctgggccaaatccgctccctcctcagtgtcaggatgggcaaggaagaggagttgctcatg
atcaatgggctgggagacataatgaacaacaaggtgttttaccagcatcccaacctcatg
agagtcctgggcatgcacgagacggtgatggaggtgatggtgaacgtgttgggtacagag
aaatctcagattgcatttccaaagatggttgctagctgctgccgtttcctttgctatttc
tgtcgaattagccggcaaaatcagaaggccatgtttgagcatctgagttatcttctggag
aatagcagtgttggcctagcctccccgtcgatgaggggatccaccccgctggatgtggca
gcttcctctgtgatggacaacaatgagttagcgctgagcttagaggaaccagacctcgag
aaggtggtgacctacttggcaggctgtggcctacagagctgccccatgcttctggccaaa
ggataccctgatgtcggctggaaccccattgaaggggaacgctacctgtccttcctgagg
tttgctgtcttcgtgaacagtgagagtgtggaagaaaacgccagcgttgtggtcaagctg
ctcatcagacgcccagagtgcttcggcccggccctgcggggtgaggggggaaacgggctc
ttggcagccatgcagggtgccattaagatctctgagaacccagcgctcgacctcccctct
caaggatacaaaagagaagtcagcacgggggacgatgaagaggaagaagaaatcgtgcat
atgggcaatgcaattatgtcattttattcggcccttatagatctactgggccgctgtgct
cctgaaatgcacctcatccagacaggaaagggggaagccatccgcatcaggtccatcctg
cgctccctggtccccacagaagacctggttgggatcatcagcatccccttgaaactgccc
tccctcaacaaagatgggtcggtcagtgagccagatatggcggccaatttctgccctgac
cacaaggcacctatggtgctgttcttggaccgcgtttatggcattaaggatcaaactttt
ctgctccacttgctggaggttggatttttacctgacctaagagcttctgcctctctagat
acagtttccctaagcaccacagaggctgcgcttgcactaaataggtatatatgttctgct
gtgctcccgctcctcacaagatgtgcccctctctttgccggaacagaacactgcacctct
ctgattgattccacactgcagacaatatacaggctatccaagggacgttccctcaccaaa
gcacaaagggacactatagaagaatgtttgcttgccatttgcaatcacttgaggccttcc
atgttacagcaactcctgcgacgcctcgtttttgatgtgccgcaactcaatgaatactgc
aaaatgcctctcaagcttctgacgaatcactatgaacagtgttggaagtattactgcctg
ccttcaggatgggggagctacgggctagctgtggaagaagagctgcacctaacggagaag
cttttctgggggatttttgactcgctctcccataagaaatatgacccagatcttttccga
atggccctgccttgtctcagtgctatagctggggccttgccaccagattatttagatacc
agaatcacagccacgttggagaaacagatctcagtggatgcggatggcaactttgaccca
aaacctattaacaccatgaatttttccttgcctgaaaaattggaatacatcgtcaccaag
tatgctgagcattcacatgataaatgggcctgtgacaagagtcagagtggatggaaatat
gggatttccctggatgaaaatgtgaagacccacccactgataaggcctttcaagacatta
acggagaaggagaaggaaatttatcgctggcctgcgcgagagtccctgaaaaccatgctg
gctgtgggctggactgtggagaggaccaaagagggagaagctttggttcaacagcgggaa
aatgagaagcttcgaagtgtgtcccaggccaaccagggcaacagctacagtcctgctccc
ctcgacctctcaaacgttgtgctctccagagagctccagggaatggtggaggtcgtggct
gagaactatcacaatatctgggccaagaagaagaagctggagctggagagcaaaggtggt
ggcagccaccctcttctggtaccatatgacaccttgactgccaaggaaaagttcaaggac
cgggagaaggcacaggacctgtttaagttcctccaagtgaatggcatcatagtttccagg
ggtatgaaggatatggagctggatgcctcctccatggagaagaggtttgcctataagttc
ttgaagaagatcctgaaatacgttgattctgctcaagaatttattgcccatttagaagcc
attgtcagcagtgggaaaactgaaaagtctccccgtgaccaggagatcaaattctttgcc
aaagttctcctcccgctggttgaccagtacttcaccagtcattgcctctacttcttgtca
tcccctctgaagccccttagcagcagcggatatgcctcccataaggagaaagaaatggtg
gccggcctgttctgcaaacttgccgctctcgttagacacagaatttccctctttggtagt
gattctactacaatggtgagctgtcttcacatcttagctcagacacttgacacaaggact
gtcatgaagtcaggctcagagctggtgaaggctgggttacgagcattctttgaaaatgct
gcagaagatttggagaagacttcagaaaacctgaaacttgggaagttcacccattcccga
acgcagattaaaggcgtttctcagaatattaactacactacagtggctctgctccccatc
ctgacgtccatctttgagcacgtcactcagcatcagtttggaatggatctactcttgggt
gatgtgcagatttcatgctaccacatactgtgcagcctctactcccttgggacgggaaag
aacatttatgttgaaaggcaacgccctgcccttggagaatgtctggcctcgctggcagct
gccataccagtggcattcctggagcccacccttaatcgctacaatccactctcggtcttc
aacaccaaaacccccagggagaggtctattctggggatgccagacacggtagaagacatg
tgtcctgacatcccccagctggaaggcctgatgaaggaaatcaacgacctggccgagtca
ggggcccggtacacagagatgccccatgtcatcgaggtgatcttacccatgctctgcaac
tacttgtcctactggtgggagcggggtcctgagaacctgccccccagcacagggccatgc
tgcaccaaggtcacctctgaacacctcagtctcatcctgggcaacattctgaaaatcatc
aacaacaacctgggcatcgatgaggcctcctggatgaagcgcattgcagtgtatgcacag
cccatcatcagcaaagccaggcccgacctgctgagaagccacttcatcccaactctggag
aagctgaagaaaaaggctgtcaagacggtgcaggaggaggagcagttgaaagccgatggc
aaaggggacacccaggaggcagaactcctcatcctggacgagttcgcggtcctctgcaga
gatctctatgccttctaccccatgctgatccgctacgtggacaacaacagatctaactgg
ctgaaaagtcctgatgctgattctgaccagctcttccgcatggtggcagaagtcttcatt
ctgtggtgtaaatctcataacttcaagagagaagagcaaaattttgtgattcagaatgaa
attaataatttggcatttttaactggagacagcaaaagcaagatgtcaaaagccatgcaa
gtaaagtctggaggacaagaccaggagcggaagaagacaaagcggcggggagacttgtat
tccatccagacctccctcatcgtggctgcactcaagaaaatgctgcccattggtttgaat
atgtgtactccaggcgaccaggagctgatctccctcgcaaaatcgcgatacagccatagg
gacacagatgaagaggtcagagaacatctgcggaacaacttgcacttgcaggaaaagtct
gatgacccagctgtaaaatggcaactgaacctctacaaggatgttctgaagagtgaagaa
cctttcaatccggaaaagacagtggagcgtgtgcagagaatttcagcagctgtcttccac
ctggaacaggtggaacagcctttgaggtccaagaaggccgtctggcacaaactgttatca
aagcaacggaaacgggcagtggtggcctgtttcaggatggcccctctctacaacctgccc
aggcaccgctctattaacctcttcctccatggctatcagagattttggatagaaacagag
gagtattcctttgaagagaaactagtacaggatttggctaaatctccaaaggtggaagag
gaggaggaggaagagacagaaaaacaacctgacccactacatcagatcattctctatttt
agccgcaacgctctcacggagaggagcaaattggaagacgaccctttgtacacctcctat
tccagcatgatggccaagagttgtcaaagtggtgaggatgaagaagaagatgaagacaag
gaaaaaacattcgaagagaaagagatggagaagcaaaaaaccctctatcagcaagctcgg
ctgcatgagcgtggtgctgcagagatggtccttcagatgataagcgctagcaaaggtgag
atgagccccatggtggttgagacgctgaagctggggatcgccattctgaacggaggcaat
gctggtgtgcaacagaaaatgctagattacctaaaggagaaaaaggatgctggattcttt
caaagcctttctggtcttatgcagtcttgcagtgtccttgatttgaatgcatttgagagg
cagaataaagctgaaggcctggggatggtgactgaagaaggaacactcattgttcgggaa
cgtggtgaaaaagtactccagaatgacgagttcacgcgtgatctctttagattcctacag
ttactttgtgagggacataacagtgactttcagaacttcctgcggactcagatgggcaac
accaccaccgtgaatgtcatcatcagcactgtggactaccttctgcgtctgcaggaatca
atcagtgatttctactggtattattcagggaaggacatcattgatgaatctggacagcac
aatttttccaaagctctggcagtcaccaagcagattttcaattctcttacagaatacatc
cagggcccttgcattggtaatcaacagagcctggctcacagcaggctgtgggacgcagtg
gttggcttcctccatgtctttgctaatatgcagatgaaactctctcaggattccagtcag
atcgagctgctgaaggaactcttggatctccttcaggacatggtggtgatgcttctgtcc
ctcctggaagggaatgtggtaaatggcaccattggcaagcagatggttgacacactggta
gaatcatctaccaatgtagaaatgatcttgaaattctttgacatgttcttgaaacttaaa
gacttaaccagctcagacaccttcaaagaatatgacccagatggtaaaggaattatctcc
aaaaaagaattccagaaggccatggaagggcaaaaacagtacacgcagtcagagattgac
tttctcctgtcgtgtgcagaagctgatgagaatgacatgtttaattacgttgattttgta
gaccggttccatgagccagccaaggacatagggtttaatgtggctgtgttattgacaaat
ctttctgaacacatgccaaacgattcccgcctgaagtgtctgttggacccagcagaaagt
gtgctaaattacttcgaaccctacctaggacgcatcgagatcatgggtggggccaagaag
attgagcgtgtttattttgagatcagtgaatccagtcgcactcagtgggagaagccccag
gtgaaggaatctaagcgacagttcatttttgatgttgtcaatgaaggtggggagcaggaa
aagatggagctgtttgtgaacttctgtgaggacaccatctttgaaatgcagttagcatct
cagatctctgaatccgattcagctgacaggccagaagaggaggaagaagatgaagattct
tcttacgtgttagaaattgcgggtgaagaggaagaagacgggtctcttgagccggcctct
gcatttgctatggcctgtgcctctgtgaagaggaatgtcaccgacttcctgaagagagca
accctgaagaacctcaggaagcagtacaggaacgtgaaaaagatgactgcgaaggagctg
gtgaaggtgctcttctcctttttctggatgctgttcgtggggctattccagttgctcttc
accatcctgggaggaatctttcagatcctctggagcacagtgtttggagggggcctggta
gaaggggcaaagaacatcagagtgaccaagatcctgggtgacatgcctgacccaacccaa
tttggtatccatgatgacactatggaggctgagagggcagaggtgatggagccaggtatc
accactgaactagtacacttcataaagggggagaagggagatacagatatcatgtcagac
ctctttggactccacccaaagaaagagggcagcttaaagcatgggcctgaagtgggtttg
ggtgacctctcagaaattattggcaaggatgaaccccctacattagagagtactgtacag
aagaagaggaaagctcaggcagcagaaatgaaagcagcaaatgaagcagaaggaaaagta
gaatccgagaaggcagacatggaagatggagagaaggaagacaaagacaaagaagaggag
caagctgagtacctgtggacagaagtgacaaaaaagaagaagcggcggtgtggtcagaag
gttgagaagccggaagctttcacagccaatttctttaaagggctggaaatctatcagacc
aagttactgcattacctggccaggaatttctacaacctgaggttccttgctctgtttgta
gccttcgctatcaacttcatcctgcttttttataaggtcactgaagaacctttagaagaa
gagacagaggatgttgcaaacctatggaattcctttaatgacgaggaagaggaagaagcg
atggtattctttgtccttcaggagagcaccgggtatatggcaccaaccctgcgtgccctg
gccatcatccataccatcatctctctagtctgtgtggtgggctactactgcctgaaggtg
cctttggtggttttcaaaagggaaaaagaaatcgccaggaagctggagtttgatggccta
tatatcaccgaacagccatctgaagatgacatcaaggggcagtgggaccgcttggtgatc
aacacaccatcttttcctaataactactgggacaagtttgtaaagagaaaggtgatcaac
aagtatggagatctctacggagcagaacgcattgctgaacttctgggtttggacaaaaat
gctcttgactttagcccagtagaagagaccaaagcagaagcggcttctctggtgtcatgg
ctaagttccatagacatgaagtaccatatctggaagcttggagttgtttttactgacaac
tcctttctctaccttgcctggtatacaaccatgtcagtcctgggccactacaataacttc
ttctttgctgctcacctattggacatcgcaatgggcttcaagacactgaggaccattctg
tcatctgtaactcacaatggcaaacagttggttctgactgtcggtctcctggccgtggtg
gtttatctctatactgtggtggctttcaacttcttccgcaagttctacaacaaaagcgaa
gacgatgacgagcccgatatgaagtgcgacgacatgatgacgtgttaccttttccacatg
tacgtgggagtgagagcaggaggtggcattggtgatgaaattgaagaccctgctggtgat
ccttatgaaatgtatcgcattgtctttgacattacctttttcttcttcgtcattgtcatc
ttgctggccatcattcaaggtcttattattgatgctttcggagagctaagagaccagcag
gaacaagtacgagaagatatggagactaaatgtttcatctgtgggattggcaatgactac
tttgacacaacccctcatggttttgaaacacatacattacaagagcacaacttagccaac
tacttgttctttctgatgtatttgattaataaagatgaaacagagcacacgggtcaggaa
tcttatgtctggaagatgtaccaagaaaggtgttgggatttcttcccagccggtgactgc
tttcgtaaacaatatgaagatcagcttggataa

DBGET integrated database retrieval system