KEGG   Homo sapiens (human): 6271Help
Entry
6271              CDS       T01001                                 

Gene name
S100A1, S100, S100-alpha, S100A
Definition
(RefSeq) S100 calcium binding protein A1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21
AA seq 94 aa AA seqDB search
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMK
ELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgggctctgagctggagacggcgatggagaccctcatcaacgtgttccacgcccactcg
ggcaaagagggggacaagtacaagctgagcaagaaggagctgaaagagctgctgcagacg
gagctctctggcttcctggatgcccagaaggatgtggatgctgtggacaaggtgatgaag
gagctagacgagaatggagacggggaggtggacttccaggagtatgtggtgcttgtggct
gctctcacagtggcctgtaacaatttcttctgggagaacagttga

DBGET integrated database retrieval system