KEGG   Homo sapiens (human): 6272Help
Entry
6272              CDS       T01001                                 

Gene name
SORT1, Gp95, LDLCQ6, NT3, NTR3
Definition
(RefSeq) sortilin 1
  KO
K12388  
sortilin
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    6272 (SORT1)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    6272 (SORT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.3; 1p21.3-p13.1
AA seq 831 aa AA seqDB search
MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGL
RAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDS
TGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSG
KVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLW
VSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIG
VKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDM
VFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLS
EDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLS
EPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHS
SRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSY
TIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVT
KQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPG
DKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKK
YVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atggagcggccctggggagctgcggacggcctctcgcgctggccccatggcctcggcctc
ctcctcctcctgcagctgctgccgccgtcgaccctcagccaggaccggctggacgcgccg
ccgccgcccgctgcgccgctgccgcgctggtctggccccatcggggtgagctgggggctg
cgggcggccgcagccgggggcgcgtttccccgcggcggccgttggcgtcgcagcgcgccg
ggcgaggacgaggagtgcggccgggtccgggacttcgtcgccaagctggccaacaacacg
caccagcatgtgtttgatgatctcagaggctcagtatccttgtcctgggttggagatagc
actggggtcattctagtcttgactaccttccatgtaccactggtaattatgacttttgga
cagtccaagctatatcgaagtgaggattatgggaagaactttaaggatattacagatctc
atcaataacacctttattcggactgaatttggcatggctattggtcctgagaactctgga
aaggtggtgttaacagcagaggtgtctggaggaagtcgtggaggaagaatctttagatca
tcagattttgcgaagaattttgtgcaaacagatctcccttttcatcctctcactcagatg
atgtatagccctcagaattctgattatcttttagctctcagcactgaaaatggcctgtgg
gtgtccaagaattttgggggaaaatgggaagaaatccacaaagcagtatgtttggccaaa
tggggatcagacaacaccatcttctttacaacctatgcaaatggctcctgcaaagctgac
cttggggctctggaattatggagaacttcagacttgggaaaaagcttcaaaactattggt
gtgaaaatctactcatttggtcttgggggacgtttcctttttgcctctgtgatggctgat
aaggatacaacaagaaggatccacgtttcaacagatcaaggggacacatggagcatggcc
cagctcccctccgtgggacaggaacagttctattctattctggcagcaaatgatgacatg
gtattcatgcatgtagatgaacctggagacactgggtttggcacaatctttacctcagat
gatcgaggcattgtctattccaagtctttggaccgacatctctacactaccacaggcgga
gagacggactttaccaacgtgacctccctccgcggcgtctacataacaagcgtgctctcc
gaagataattctatccagaccatgatcacttttgaccaaggaggaaggtggacgcacctg
aggaagcctgaaaacagtgaatgtgatgctacagcaaaaaacaagaatgagtgcagcctt
catattcatgcttcctacagcatctcccagaaactgaatgttccaatggccccactctca
gagccgaatgccgtaggcattgtcattgctcatggtagcgtgggggatgccatctcagtg
atggttccagatgtgtacatctcagatgatgggggttactcctggacaaagatgctggaa
ggaccccactattacaccatcctggattctggaggcatcattgtggccattgagcacagc
agccgtcctatcaatgtgattaagttctccacagacgaaggtcaatgctggcaaacctac
acgttcaccagggaccccatctatttcactggcctagcttcagaacctggagctaggtcc
atgaatatcagcatttggggcttcacagaatctttcctgaccagccagtgggtctcctac
accattgattttaaagatatccttgaaaggaactgtgaagagaaggactataccatatgg
ctggcacactccacagaccctgaagattatgaagatggctgcattttgggctacaaagaa
cagtttctgcggctacgcaagtcatccgtgtgtcagaatggtcgagactatgttgtgacc
aagcagccctccatctgcctctgttccctggaggactttctctgtgattttggctactac
cgtccagaaaatgactccaagtgtgtggaacagccagaactgaagggccacgacctggag
ttttgtctgtacggaagagaagaacacctaacaacaaatgggtaccggaaaattccaggg
gacaaatgccagggtggggtaaatccagttcgagaagtaaaagacttgaaaaagaaatgc
acaagcaactttttgagtccggaaaaacagaattccaagtcaaattctgttccaattatc
ctggccatcgtgggattgatgctggtcacagtcgtagcaggagtgctcattgtgaagaaa
tatgtctgtgggggaaggttcctggtgcatcgatactctgtgctgcagcagcatgcagag
gccaatggtgtggatggtgtggatgctttggacacagcctcccacactaataaaagtggt
tatcatgatgactcagatgaggacctcttggaatag

DBGET integrated database retrieval system