KEGG   Homo sapiens (human): 6272Help
Entry
6272              CDS       T01001                                 

Gene name
SORT1, Gp95, LDLCQ6, NT3
Definition
sortilin 1
Orthology
K12388  
sortilin
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Neurotrophin signaling pathway
Class
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.3; 1p21.3-p13.1
AA seq 694 aa AA seqDB search
MTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGR
IFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAV
CLAKWGSDNTIFFTTYANGSCTDLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASV
MADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIF
TSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRW
THLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDA
ISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCW
QTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDY
TIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDF
GYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLK
KKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQ
HAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgacttttggacagtccaagctatatcgaagtgaggattatgggaagaactttaaggat
attacagatctcatcaataacacctttattcggactgaatttggcatggctattggtcct
gagaactctggaaaggtggtgttaacagcagaggtgtctggaggaagtcgtggaggaaga
atctttagatcatcagattttgcgaagaattttgtgcaaacagatctcccttttcatcct
ctcactcagatgatgtatagccctcagaattctgattatcttttagctctcagcactgaa
aatggcctgtgggtgtccaagaattttgggggaaaatgggaagaaatccacaaagcagta
tgtttggccaaatggggatcagacaacaccatcttctttacaacctatgcaaatggctcc
tgcactgaccttggggctctggaattatggagaacttcagacttgggaaaaagcttcaaa
actattggtgtgaaaatctactcatttggtcttgggggacgtttcctttttgcctctgtg
atggctgataaggatacaacaagaaggatccacgtttcaacagatcaaggggacacatgg
agcatggcccagctcccctccgtgggacaggaacagttctattctattctggcagcaaat
gatgacatggtattcatgcatgtagatgaacctggagacactgggtttggcacaatcttt
acctcagatgatcgaggcattgtctattccaagtctttggaccgacatctctacactacc
acaggcggagagacggactttaccaacgtgacctccctccgcggcgtctacataacaagc
gtgctctccgaagataattctatccagaccatgatcacttttgaccaaggaggaaggtgg
acgcacctgaggaagcctgaaaacagtgaatgtgatgctacagcaaaaaacaagaatgag
tgcagccttcatattcatgcttcctacagcatctcccagaaactgaatgttccaatggcc
ccactctcagagccgaatgccgtaggcattgtcattgctcatggtagcgtgggggatgcc
atctcagtgatggttccagatgtgtacatctcagatgatgggggttactcctggacaaag
atgctggaaggaccccactattacaccatcctggattctggaggcatcattgtggccatt
gagcacagcagccgtcctatcaatgtgattaagttctccacagacgaaggtcaatgctgg
caaacctacacgttcaccagggaccccatctatttcactggcctagcttcagaacctgga
gctaggtccatgaatatcagcatttggggcttcacagaatctttcctgaccagccagtgg
gtctcctacaccattgattttaaagatatccttgaaaggaactgtgaagagaaggactat
accatatggctggcacactccacagaccctgaagattatgaagatggctgcattttgggc
tacaaagaacagtttctgcggctacgcaagtcatccgtgtgtcagaatggtcgagactat
gttgtgaccaagcagccctccatctgcctctgttccctggaggactttctctgtgatttt
ggctactaccgtccagaaaatgactccaagtgtgtggaacagccagaactgaagggccac
gacctggagttttgtctgtacggaagagaagaacacctaacaacaaatgggtaccggaaa
attccaggggacaaatgccagggtggggtaaatccagttcgagaagtaaaagacttgaaa
aagaaatgcacaagcaactttttgagtccggaaaaacagaattccaagtcaaattctgtt
ccaattatcctggccatcgtgggattgatgctggtcacagtcgtagcaggagtgctcatt
gtgaagaaatatgtctgtgggggaaggttcctggtgcatcgatactctgtgctgcagcag
catgcagaggccaatggtgtggatggtgtggatgctttggacacagcctcccacactaat
aaaagtggttatcatgatgactcagatgaggacctcttggaatag

DBGET integrated database retrieval system