KEGG   Homo sapiens (human): 629Help
Entry
629               CDS       T01001                                 

Gene name
CFB, AHUS4, ARMD14, BF, BFD, CFAB, CFBD, FB, FBI12, GBG, H2-Bf, PBF2
Definition
(RefSeq) complement factor B
  KO
K01335  
component factor B [EC:3.4.21.47]
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Staphylococcus aureus infection
Disease
H00104  
Alternative complement pathway component defects
H00821  
Macular degeneration
H01434  
Atypical hemolytic uremic syndrome (aHUS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    629 (CFB)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    629 (CFB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.47  alternative-complement-pathway C3/C5 convertase
     629 (CFB)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   629 (CFB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P00751(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.33
AA seq 764 aa AA seqDB search
MGSNLSPQLCLMPFILGLLSGGVTTTPWSLARPQGSCSLEGVEIKGGSFRLLQEGQALEY
VCPSGFYPYPVQTRTCRSTGSWSTLKTQDQKTVRKAECRAIHCPRPHDFENGEYWPRSPY
YNVSDEISFHCYDGYTLRGSANRTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQ
YRLEDSVTYHCSRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTE
TIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKV
ASYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQ
AVYSMMSWPDDVPPEGWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPRE
DYLDVYVFGVGPLVNQVNINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGM
VWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVS
VGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCT
EGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDA
QYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWG
VVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLGFL
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggggagcaatctcagcccccaactctgcctgatgccctttatcttgggcctcttgtct
ggaggtgtgaccaccactccatggtctttggcccggccccagggatcctgctctctggag
ggggtagagatcaaaggcggctccttccgacttctccaagagggccaggcactggagtac
gtgtgtccttctggcttctacccgtaccctgtgcagacacgtacctgcagatctacgggg
tcctggagcaccctgaagactcaagaccaaaagactgtcaggaaggcagagtgcagagca
atccactgtccaagaccacacgacttcgagaacggggaatactggccccggtctccctac
tacaatgtgagtgatgagatctctttccactgctatgacggttacactctccggggctct
gccaatcgcacctgccaagtgaatggccgatggagtgggcagacagcgatctgtgacaac
ggagcggggtactgctccaacccgggcatccccattggcacaaggaaggtgggcagccag
taccgccttgaagacagcgtcacctaccactgcagccgggggcttaccctgcgtggctcc
cagcggcgaacgtgtcaggaaggtggctcttggagcgggacggagccttcctgccaagac
tccttcatgtacgacacccctcaagaggtggccgaagctttcctgtcttccctgacagag
accatagaaggagtcgatgctgaggatgggcacggcccaggggaacaacagaagcggaag
atcgtcctggacccttcaggctccatgaacatctacctggtgctagatggatcagacagc
attggggccagcaacttcacaggagccaaaaagtgtctagtcaacttaattgagaaggtg
gcaagttatggtgtgaagccaagatatggtctagtgacatatgccacataccccaaaatt
tgggtcaaagtgtctgaagcagacagcagtaatgcagactgggtcacgaagcagctcaat
gaaatcaattatgaagaccacaagttgaagtcagggactaacaccaagaaggccctccag
gcagtgtacagcatgatgagctggccagatgacgtccctcctgaaggctggaaccgcacc
cgccatgtcatcatcctcatgactgatggattgcacaacatgggcggggacccaattact
gtcattgatgagatccgggacttgctatacattggcaaggatcgcaaaaacccaagggag
gattatctggatgtctatgtgtttggggtcgggcctttggtgaaccaagtgaacatcaat
gctttggcttccaagaaagacaatgagcaacatgtgttcaaagtcaaggatatggaaaac
ctggaagatgttttctaccaaatgatcgatgaaagccagtctctgagtctctgtggcatg
gtttgggaacacaggaagggtaccgattaccacaagcaaccatggcaggccaagatctca
gtcattcgcccttcaaagggacacgagagctgtatgggggctgtggtgtctgagtacttt
gtgctgacagcagcacattgtttcactgtggatgacaaggaacactcaatcaaggtcagc
gtaggaggggagaagcgggacctggagatagaagtagtcctatttcaccccaactacaac
attaatgggaaaaaagaagcaggaattcctgaattttatgactatgacgttgccctgatc
aagctcaagaataagctgaaatatggccagactatcaggcccatttgtctcccctgcacc
gagggaacaactcgagctttgaggcttcctccaactaccacttgccagcaacaaaaggaa
gagctgctccctgcacaggatatcaaagctctgtttgtgtctgaggaggagaaaaagctg
actcggaaggaggtctacatcaagaatggggataagaaaggcagctgtgagagagatgct
caatatgccccaggctatgacaaagtcaaggacatctcagaggtggtcacccctcggttc
ctttgtactggaggagtgagtccctatgctgaccccaatacttgcagaggtgattctggc
ggccccttgatagttcacaagagaagtcgtttcattcaagttggtgtaatcagctgggga
gtagtggatgtctgcaaaaaccagaagcggcaaaagcaggtacctgctcacgcccgagac
tttcacatcaacctctttcaagtgctgccctggctgaaggagaaactccaagatgaggat
ttgggttttctataa

DBGET integrated database retrieval system