KEGG   Homo sapiens (human): 629Help
Entry
629               CDS       T01001                                 

Gene name
CFB, AHUS4, ARMD14, BF, BFD, CFAB, CFBD, FB, FBI12, GBG, H2-Bf, PBF2
Definition
(RefSeq) complement factor B
  KO
K01335  
component factor B [EC:3.4.21.47]
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Staphylococcus aureus infection
Disease
H00104  
Alternative complement pathway component defects
H00821  
Age-related macular degeneration
H01434  
Atypical hemolytic uremic syndrome (aHUS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    629 (CFB)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    629 (CFB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.47  alternative-complement-pathway C3/C5 convertase
     629 (CFB)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   629 (CFB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P00751(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.33
AA seq 764 aa AA seqDB search
MGSNLSPQLCLMPFILGLLSGGVTTTPWSLARPQGSCSLEGVEIKGGSFRLLQEGQALEY
VCPSGFYPYPVQTRTCRSTGSWSTLKTQDQKTVRKAECRAIHCPRPHDFENGEYWPRSPY
YNVSDEISFHCYDGYTLRGSANRTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQ
YRLEDSVTYHCSRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTE
TIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKV
ASYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQ
AVYSMMSWPDDVPPEGWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPRE
DYLDVYVFGVGPLVNQVNINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGM
VWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVS
VGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCT
EGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDA
QYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWG
VVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLGFL
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggggagcaatctcagcccccaactctgcctgatgccctttatcttgggcctcttgtct
ggaggtgtgaccaccactccatggtctttggcccggccccagggatcctgctctctggag
ggggtagagatcaaaggcggctccttccgacttctccaagagggccaggcactggagtac
gtgtgtccttctggcttctacccgtaccctgtgcagacacgtacctgcagatctacgggg
tcctggagcaccctgaagactcaagaccaaaagactgtcaggaaggcagagtgcagagca
atccactgtccaagaccacacgacttcgagaacggggaatactggccccggtctccctac
tacaatgtgagtgatgagatctctttccactgctatgacggttacactctccggggctct
gccaatcgcacctgccaagtgaatggccgatggagtgggcagacagcgatctgtgacaac
ggagcggggtactgctccaacccgggcatccccattggcacaaggaaggtgggcagccag
taccgccttgaagacagcgtcacctaccactgcagccgggggcttaccctgcgtggctcc
cagcggcgaacgtgtcaggaaggtggctcttggagcgggacggagccttcctgccaagac
tccttcatgtacgacacccctcaagaggtggccgaagctttcctgtcttccctgacagag
accatagaaggagtcgatgctgaggatgggcacggcccaggggaacaacagaagcggaag
atcgtcctggacccttcaggctccatgaacatctacctggtgctagatggatcagacagc
attggggccagcaacttcacaggagccaaaaagtgtctagtcaacttaattgagaaggtg
gcaagttatggtgtgaagccaagatatggtctagtgacatatgccacataccccaaaatt
tgggtcaaagtgtctgaagcagacagcagtaatgcagactgggtcacgaagcagctcaat
gaaatcaattatgaagaccacaagttgaagtcagggactaacaccaagaaggccctccag
gcagtgtacagcatgatgagctggccagatgacgtccctcctgaaggctggaaccgcacc
cgccatgtcatcatcctcatgactgatggattgcacaacatgggcggggacccaattact
gtcattgatgagatccgggacttgctatacattggcaaggatcgcaaaaacccaagggag
gattatctggatgtctatgtgtttggggtcgggcctttggtgaaccaagtgaacatcaat
gctttggcttccaagaaagacaatgagcaacatgtgttcaaagtcaaggatatggaaaac
ctggaagatgttttctaccaaatgatcgatgaaagccagtctctgagtctctgtggcatg
gtttgggaacacaggaagggtaccgattaccacaagcaaccatggcaggccaagatctca
gtcattcgcccttcaaagggacacgagagctgtatgggggctgtggtgtctgagtacttt
gtgctgacagcagcacattgtttcactgtggatgacaaggaacactcaatcaaggtcagc
gtaggaggggagaagcgggacctggagatagaagtagtcctatttcaccccaactacaac
attaatgggaaaaaagaagcaggaattcctgaattttatgactatgacgttgccctgatc
aagctcaagaataagctgaaatatggccagactatcaggcccatttgtctcccctgcacc
gagggaacaactcgagctttgaggcttcctccaactaccacttgccagcaacaaaaggaa
gagctgctccctgcacaggatatcaaagctctgtttgtgtctgaggaggagaaaaagctg
actcggaaggaggtctacatcaagaatggggataagaaaggcagctgtgagagagatgct
caatatgccccaggctatgacaaagtcaaggacatctcagaggtggtcacccctcggttc
ctttgtactggaggagtgagtccctatgctgaccccaatacttgcagaggtgattctggc
ggccccttgatagttcacaagagaagtcgtttcattcaagttggtgtaatcagctgggga
gtagtggatgtctgcaaaaaccagaagcggcaaaagcaggtacctgctcacgcccgagac
tttcacatcaacctctttcaagtgctgccctggctgaaggagaaactccaagatgaggat
ttgggttttctataa

DBGET integrated database retrieval system