KEGG   Homo sapiens (human): 6296Help
Entry
6296              CDS       T01001                                 

Gene name
ACSM3, SA, SAH
Definition
(RefSeq) acyl-CoA synthetase medium-chain family member 3 (EC:6.2.1.2)
  KO
K01896  
medium-chain acyl-CoA synthetase [EC:6.2.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    6296 (ACSM3)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.2  butyrate---CoA ligase
     6296 (ACSM3)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   6296 (ACSM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.11
AA seq 586 aa AA seqDB search
MLARVTRKMLRHAKCFQRLAIFGSVRALHKDNRTATPQNFSNYESMKQDFKLGIPEYFNF
AKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMRWSFEELGSLSRKFANILSEACSLQRG
DRVILILPRVPEWWLANVACLRTGTVLIPGTTQLTQKDILYRLQSSKANCIITNDVLAPA
VDAVASKCENLHSKLIVSENSREGWGNLKELMKHASDSHTCVKTKHNEIMAIFFTSGTSG
YPKMTAHTHSSFGLGLSVNGRFWLDLTPSDVMWNTSDTGWAKSAWSSVFSPWIQGACVFT
HHLPRFEPTSILQTLSKYPITVFCSAPTVYRMLVQNDITSYKFKSLKHCVSAGEPITPDV
TEKWRNKTGLDIYEGYGQTETVLICGNFKGMKIKPGSMGKPSPAFDVKIVDVNGNVLPPG
QEGDIGIQVLPNRPFGLFTHYVDNPSKTASTLRGNFYITGDRGYMDKDGYFWFVARADDV
ILSSGYRIGPFEVENALNEHPSVAESAVVSSPDPIRGEVVKAFVVLNPDYKSHDQEQLIK
EIQEHVKKTTAPYKYPRKVEFIQELPKTISGKTKRNELRKKEWKTI
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgctagctcgtgtcaccaggaagatgctacgtcatgccaagtgttttcagcgcctagca
atttttggttctgtgagggcactgcataaagataatagaacagcaacccctcagaatttc
tccaactatgaatccatgaaacaggacttcaaactggggattccagagtatttcaacttt
gctaaagatgtcctggaccaatggactgataaggaaaaggctggaaagaaaccttcaaat
ccagccttctggtggatcaacagaaatggagaagagatgcgatggagttttgaggaactg
ggatctctgtccagaaaatttgccaatatactttcagaagcctgttccctacaaagagga
gatcgggtaattctgattctgcccagggtcccagagtggtggcttgcaaatgtggcctgt
ctgcgaacagggacagttttaattccaggaaccactcagctgacccagaaagacattctc
tacagactacaatcttcaaaagcaaactgcattatcaccaatgatgttttagccccagca
gtagacgctgttgcatccaaatgtgaaaatctgcactccaagctgattgtatcagagaac
tccagagaggggtgggggaacctcaaggagttgatgaaacatgccagtgacagccacacc
tgtgtgaagacaaaacacaatgagatcatggccatattctttaccagtggaacaagtgga
tatccgaaaatgactgcacacacccacagcagttttggtttaggattatctgtaaatgga
aggttctggctagatttgacaccctcagatgtgatgtggaatacctcagatacgggctgg
gcaaagtctgcatggagtagtgttttttctccgtggatccagggagcatgtgtattcaca
caccatttaccccgttttgagccgacttctatcttgcaaacactctccaagtaccccatc
acagtcttctgttcagcaccaactgtataccgaatgcttgtacagaatgatataaccagc
tataagtttaaaagcttaaagcactgtgtgagtgctggggaaccaattacccctgacgtg
actgaaaaatggagaaacaagacgggcctggatatctacgaaggatatggacagactgaa
acggtgctaatctgtggaaattttaagggaatgaaaattaaacctggctcaatgggaaaa
ccttctcctgctttcgatgttaagattgtagatgtaaatggcaatgttctacctcctgga
caagaaggagatattggcattcaagttctacccaaccgaccatttggcctttttactcat
tacgtagataatccttcaaaaacagcttcaactctacgaggcaatttctatatcactggg
gacagaggatatatggataaagatgggtatttctggtttgttgcaagagcagatgatgtc
atattatcctctggctatcgaattggaccatttgaggtagaaaatgccctgaatgaacac
ccttcagttgcagagtcagctgttgtcagcagcccagaccccatcagaggagaggtagta
aaggcttttgtcgttctaaatcctgattacaagtcacatgatcaagaacaactaataaag
gagattcaggagcatgttaaaaaaactacagcaccttacaaatatcccagaaaggtagaa
tttattcaagagctgccaaagactatcagtgggaagacaaaaagaaatgaactgaggaag
aaagaatggaagacaatttaa

DBGET integrated database retrieval system